Protein Model on 3n0p_B_1_A_1 (TEMPLATE: 3n0p )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) B 1 (B) polymer(polypeptide(L)) [206 aa] Prolactin receptor :PRLR_HUMAN
2 b A 1 (A) polymer(polypeptide(L)) [186 aa] Prolactin :PRL_HUMAN 127L(K) 128S(E) 157P(E) 158A(G) 184D(S) 185S(M) 186S(R) 187F(T) 207T(Y) 209Q(D) 211C(T) 212G(Y) 243S(D) 244W(L) 245N(K) 246S(T) 247S(G) 248F(W) 250R(T) 297E(D) 300Q(H) (identity: 0.0 %/24.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3n0p_B_1 identity=24.7%
queryA       112:VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQG: 210
                : **  *     *        * * *     * *   *          *     *         **            **         ** **       :
3n0p_B_1       2:LPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHR----EGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDV:  97
SecStr          :  B   EEEEEEBSSSS EEEEEE  SSSB  SEEEEEEEE----TT    EE S SSTT TTEEEE GGG  SS  EEEEEEEEETTEEEE   EEE G:    
ExpBur          :eebbebebeebebebbebbbbebeeeeeeeeeeebbbebeb----eeeeeeeebeeeeeeeeebbbbeeeebebeeebbbebbbebeeeeeebeeeebbb:    
Contact         :               bb                            bb                         bbbbb                   b b 

queryA       211:CGILQPDPPANITVTAVARNPR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW: 306
                :  * *****    *       *   *   *  *           *  * *   *             *    *     *    ** *       * ** *:
3n0p_B_1      98:TYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSLHPGQKYLVQVRCKPD--HGYWSAW: 194
SecStr          :GG B     EEEEEEEE  TTS  EEEEEEE  TT   TTSSS EEEEEEEEETT SS EE-EEEET SEEEE    TT EEEEEEEEEES--SS     :    
ExpBur          :bebbebeebeebebeeeeeeeeeebbbbebeebeebeeeeeebebbbbbebbbeeeeeeee-eebbeeeebebeebeeeeebebbbebbbe--eeeebee:    
Contact         :bb                                  bbbbbb b                                              b  b      

queryA       307:SP: 308
                :**:
3n0p_B_1     195:SP: 196
SecStr          :  :    
ExpBur          :be:    


Input Residue Numbers for Focused Sites

ex) 2,15,123