Protein Model on 3ncc_B_1_G_1 (TEMPLATE: 3ncc )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) B 1 (B) polymer(polypeptide(L)) [206 aa] Prolactin receptor :PRLR_HUMAN
2 b G 1 (B) non-polymer(CO3) CARBONATE ION 121C(K) 133E(W) (identity: 0.0 %/24.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3ncc_B_1 identity=24.7%
queryA       112:VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQG: 210
                : **  *     *        * * *     * *   *          *     *         **            **         ** **       :
3ncc_B_1       2:LPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHR----EGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDV:  97
SecStr          :  B   EEEEEEBSSSS EEEEEE  SSSB  SEEEEEEEE----TTT   EE S SSTT TTEEEE GGG  SSS EEEEEEEEETTEEEE   EEE G:    
ExpBur          :eebbebebeebebbbbebbbbebeeeeeeeeeeebbbbbeb----eeeeeeeebeeeeeeeeebbbbeeeebebeebbbbebbbebeeeeeebeeeebeb:    
Contact         :         b           b                                                                              

queryA       211:CGILQPDPPANITVTAVARNPR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW: 306
                :  * *****    *       *   *   *  *           *  * *   *             *    *     *    ** *       * ** *:
3ncc_B_1      98:TYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSLHPGQKYLVQVRCKPD--AGYWSAW: 194
SecStr          :GG B     EEEEEEEE  SSS  EEEEEEE  TT   TTSS  EEEEEEEE TT SS EE-EE TT SEEEE    TT EEEEEEEEEES--SS     :    
ExpBur          :bebbebeebeebebeeeeeeebeeebbbebeebeebeeeeeebebbbbbebbbeeeeeeee-eebbeeeebebeebeeeeebbbbbbbbbe--eeeebee:    

queryA       307:SP: 308
                :**:
3ncc_B_1     195:SP: 196
SecStr          :  :    
ExpBur          :be:    


Input Residue Numbers for Focused Sites

ex) 2,15,123