Protein Model on 3npz_C_1_B_1 (TEMPLATE: 3npz )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) C 1 (C) polymer(polypeptide(L)) [199 aa] Prolactin receptor :PRLR_RAT
2 b B 1 (B) polymer(polypeptide(L)) [202 aa] Prolactin receptor :PRLR_RAT 225T(K) 235S(W) 247S(G) 248F(W) 249Y(F) 271K(H) 272D(F) 274Q(G) 275H 276H(Q) 278V(K) 280H(F) 281D (identity: 15.4 %/25.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3npz_C_1 identity=25.4%
queryA       113:PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGC: 211
                :**  *     *        * * *     * *   *   *      *     *     *   **            **         **  *        :
3npz_C_1       3:PPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSK----EGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVT:  98
SecStr          :      EEEEEBSSSS EEEEE     TTS  EEEEEE B----TTS   EE S SSSS SSEEEE TTT  SSS EEEEEEEEETTEE     EEE GG:    
ExpBur          :bebebebeebbbeeeebbbbebeebeeeebebebebbbbb----eeeeeeeebebeeeeeeebbebeeeebbeeeebbbbbbbebeeeeeebeeeebebe:    

queryA       212:GILQPDPPANIT--VTAVARNPRWLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC--VIHDAWSGLRHVVQLRAQEEFGQGEWSE: 305
                : *  * ** * *  *         * * *  *              * *   *       *      *       *   *    ** *       * ** :
3npz_C_1      99:YIVEPEPPRNLTLEVKQXXXKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEXXE---EWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPD--HGYWSR: 193
SecStr          :GSB     EEEEEEEE ---   EEEEEEE  S TTTTTT    EEEEEEE  -- ---  EEEEESS SEEEE    TT EEEEEEEEE S--S     :    
ExpBur          :ebbebebbeebebeeee---eeebbbbebeebebeebeeeeeebebbbebbee--e---eeeeeebeeeeebebeebeeeeebebbbbbebe--ebeebe:    
Contact         :               b         b             bbb                     bb bbb bbb bb                        

queryA       306:WSPEA: 310
                :** * :
3npz_C_1     194:WSQES: 198
SecStr          :    E:    
ExpBur          :ebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123