Protein Model on 3qwr_A_1_C_1 (TEMPLATE: 3qwr )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) A 1 (A) polymer(polypeptide(L)) [295 aa] Interleukin-12 subunit beta :IL12B_HUMAN
2 b C 1 (D) polymer(polypeptide(L)) [91 aa] ADNECTIN 112V(E) 113P 115E(N) 157P(D) 188Y(P) 207T(S) 208F 209Q(F) 212G(D) 256R(Q) 258R(Q) 265F(K) 268W(R) 293R 295Q 299G(Y) 300Q(S) 301G(S) 302E(S) 303W 306W (identity: 28.6 %/27.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3qwr_A_1 identity=27.8%
queryA        39:PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG--------------TVHLLVD--VPPEEPQLSCF: 122
                :**  * ***    **      * *         *   * *  *        * * * *   *                      * *   *     * * :
3qwr_A_1      20:PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCE: 110
SecStr          :   EEEEE SS--S  SS- EEEE------TT     EESSEEEEE  SGGG EEEEEEETTEEEEEEEEEB EEETTEE   SEE   SSSSS   EEE:    
ExpBur          :ebeebebebee--eeeee-bebbb------eeeeeeeeeebebebebbeeeebbebbbebeeeeebebebbbbbeeeeeebeebbeebeeeeeebbbebb:    
Contact         :                                                                                        bbb b       

queryA       123:RKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ: 206
                : *       * *                *       *  *  *                 ** * *  *   * *    *  *  *  *         * :
3qwr_A_1     111:AKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERXRGDNKEY----EYSVECQEDS---ACPAAEESLPIEVMVDAVHKLKYENYTS: 203
SecStr          :BSSSSSEEEEEEEES  SSEEEEEEEEE SSS EEEEE   EEEEE -  TT  E----EEEEEEEETT---  TTS   S EEEEEEEEETTEEEEEEE:    
ExpBur          :bebbebebbbbbbbebeeebebebebbbbeeeeeebebeeeeeeeee-eeeeeeb----ebbbebebee---eeeeeebeeebebebebbbeebbbebee:    
Contact         :                                                  b                              b                  

queryA       207:TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS: 304
                : *    *  **** *        * *   * *  *  *    *   * *                  *     **             ***       **:
3qwr_A_1     204:SFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQXXXXXXKKDRVFTDKTSATVI----CRKXXSISVRAQDRYYSSSWS: 298
SecStr          :EE HHHHB     EEEEEEE -SSS SEEEEEE  TTS S TTTS EEEEEEE ------   EEEESSSEEEE ----   -- EEEEEEESSS     :    
ExpBur          :ebebeebbebeebeebeeeee-eeeeebebebebbeebbeeeeebbbbbbbbbe------eeeeeebeeeebebe----eee--ebbbbbbbeeeebeeb:    
Contact         :bbb  b                                             b b      b  b                        b b   bbbbb 

queryA       305:EWS: 307
                :** :
3qwr_A_1     299:EWA: 301
SecStr          :  E:    
ExpBur          :eeb:    
Contact         : b                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123