Protein Model on 4grw_D_1_E_1 (TEMPLATE: 4grw )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) D 1 (D) polymer(polypeptide(L)) [292 aa] Interleukin-12 subunit beta :IL12B_HUMAN
2 b E 1 (E) polymer(polypeptide(L)) [125 aa] Nanobody 124C4 125S(N) 126P(Y) 127L(S) 129N(R) 172Q 181P 220A(K) 239Q(E) 242H(D) 243S(T) 244W 245N(S) 246S(T) 249Y(F) (identity: 21.4 %/27.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4grw_D_1 identity=27.0%
queryA        39:PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG--------------TVHLLVD--VPPEEPQLSCF: 122
                :**  * ***    **      * *         *   * *  *        * * * *   *                      * *   *     * * :
4grw_D_1      42:PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCE: 132
SecStr          :  EEEEEE SS--S  SS- EEEE------TT     EESSEEEEEE SGGG EEEEEEETTEEEEEEEEEEEEEETTEE   SS    SSSTT   EEE:    
ExpBur          :eeeebebebeb--eeeee-bebbb------eeeeeeeeeeeebebebeeeeebbebbbeeeeeeebebebbbbeeeeeeebeebbeebeeeeeebbbebe:    

queryA       123:RKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ: 206
                : *       * *                *       *  *  *                 ** * *  *   * *    *  *  *  *         * :
4grw_D_1     133:AKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRXXNKEY----EYSVECQEDS---ACPAAEESLPIEVMVDAVHKLKYENYTS: 225
SecStr          :BSSSSSEEEEEEEES  SSEEEEEEEEE SSS EEEEE   EEEEEEE -- EEE----EEEEEEEETT---  TTS   S EEEEEEEEETTEEEEEEE:    
ExpBur          :bebbebebebbbbbebeeebebebebbbbeeeeeebebeeeeeebeeee--eebb----bbbbebebee---eeeeeebeeebebebebbbeeebbebee:    
Contact         :  bbb b                                                          b        b                         

queryA       207:TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS: 304
                : *    *  **** *              * *  *  *    *   * *                  *     **             ***       **:
4grw_D_1     226:SFFIRDIIKPDPPKNLQLKPLXXXXQ-VEVSWEYPDTWSTPHSYFSLTFCVQVQGXXXXXXXDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS: 320
SecStr          :EE GGGSB     EEEEEEE ---- -EEEEEE  TTS S TTTS EEEEEEEE ------- EEEESSSEEEE ----  TT EEEEEEEESSS     :    
ExpBur          :ebebeebbbbeebeebeeeee----e-bebebebbeebbeeeeebbbbbbbbbee-------eeeeeeeeebebe----eeeebebbbbbbbeeeebeeb:    
Contact         :             b                  b  bbbbbbb  b                                                       

queryA       305:EWS: 307
                :** :
4grw_D_1     321:EWA: 323
SecStr          :  E:    
ExpBur          :eeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123