Protein Model on 4i18_E_1_L_1 (TEMPLATE: 4i18 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) E 1 (R) polymer(polypeptide(L)) [205 aa] Prolactin receptor :PRLR_HUMAN
2 b L 1 (R) non-polymer(ACT) ACETATE ION 121C(K) 133E(W) (identity: 0.0 %/24.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4i18_E_1 identity=24.3%
queryA       113:PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGC: 211
                :**  *     *        * * *       *   *          *     *         **            **         ** **        :
4i18_E_1       3:PPGKPEIFKCRSPNKETFTCWWRPGTDGGXXTNYSLTYHR----EGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVT:  98
SecStr          :     EEEEEEBSSSSSEEEEEE      -- EEEEEEEE----SS    EE S SSTT TTEEEE GGG  TT  EEEEEEEE SS EE   EEEE SG:    
ExpBur          :eebebebeebebebbeebbbebeeeeeee--eeeebbbbe----eeeeeeeebeeeeeeeeebbbbeeeebeeeebbbbebbbebeeeeeebeeeebbbb:    
Contact         :        b           b                                                                               

queryA       212:GILQPDPPANITVTAVARNPR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS: 307
                : * *****    *       *   *   *  *           *  * *   *             *    *     *    ** *       * ** **:
4i18_E_1      99:YIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIXXKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSLHPGQKYLVQVRCKPD--HGYWSAWS: 195
SecStr          :GGB     EEEEEEEE  SSS  EEEEEEE  S  --  SS  EEEEEEEEETT SS EE-EE TT SEEEE    SSSEEEEEEEEEET--TS      :    
ExpBur          :ebbebeebeebebeeeeeeeeebbbbbebeebeee--eeeebebebbbbbeeeeeeeeee-eebeeeeeeebeebeeeeebbbbbbbebe--ebeebeeb:    

queryA       308:P: 308
                :*:
4i18_E_1     196:P: 196
SecStr          : :    
ExpBur          :e:    


Input Residue Numbers for Focused Sites

ex) 2,15,123