Protein Model on 5fuc_C_1_B_1 (TEMPLATE: 5fuc )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) C 1 (C) polymer(polypeptide(L)) [199 aa] INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-6 RECEPTOR :D6R9R8_HUMAN:IL6RA_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [160 aa] INTERLEUKIN-6 :IL6_HUMAN 127L 153F 154Q 155N 182E 183G 185S 187F 189I 247S 248F 249Y 250R 273L 296E 297E 298F 300Q (identity: 100.0 %/98.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5fuc_C_1 identity=98.5%
queryA       117:PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP: 216
                :**************************************** ***************************************************** *****:
5fuc_C_1      26:PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSXAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGAGILQP: 125
SecStr          :   EEEBS TTS EEEEE  SS   S   EEEEEEEES  - B  EEEEEE SSS SEEEEE   TT  SEEEEEEEE  SS  B    EEEEGGGGB  :    
ExpBur          :eebebbbebbeeebbbebebeeeeeebeebebebeeeeee-eeeeeeebebeeeeeebebebebeeebebebebbbbbeeeeeeeebeeeebeeeebbeb:    
Contact         :          b                         bbb                          bb b b b                           

queryA       217:DPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWT: 316
                :************************************************************ ***************************************:
5fuc_C_1     126:DPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHAVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWT: 225
SecStr          :   EEEEEE  TT TT EEEEEE  TT   SSS EEEEEEEEETT S  EEEE SSS SEEEES   TT  EEEEEEEEETTTBS        EEE    :    
ExpBur          :eebeebebeeeeeeeeebebebeebeebebeeeebebbbbbbbeeeeeeeeeebeeeeeebebeebeeeeebbbbbebbbeeeeeeebeebeebebebee:    
Contact         :                              bbbb                      b                      bbb b                


Input Residue Numbers for Focused Sites

ex) 2,15,123