Protein Model on 5fuc_D_1_I_1 (TEMPLATE: 5fuc )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) D 1 (D) polymer(polypeptide(L)) [198 aa] INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-6 RECEPTOR :D6R9R8_HUMAN:IL6RA_HUMAN
2 b I 1 (D) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose 221N 239Q (identity: 100.0 %/95.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5fuc_D_1 identity=95.6%
queryA       113:PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCG: 212
                :****************************************       *************************************************** *:
5fuc_D_1      22:PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKXXXXXXXDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGAG: 121
SecStr          :       EEEBSSSSS EEEEE  SS   TT EEEEEEE -------  EEEEEE SSS SEEEEE   TT    EEEEEEEE SS EE    EEE TTT:    
ExpBur          :ebeebebebebebbeeebbbebebeeeeeeebebbbebee-------eeeeebeeeeeeeebebebebeeeeeeebebbbebebeeeeeebeeeebebee:    

queryA       213:ILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG: 312
                :**************************************************************** ***********************************:
5fuc_D_1     122:ILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHAVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG: 221
SecStr          :SB     EEEEEEEETTEEEEEEEEEE  TT   SSS EEEEEEEEETT    EEEE SSS SEEEES   TT  EEEEEEEEETTS S        EEE:    
ExpBur          :bbebeebeebebeeeeeeeeebebebeebeebebeeeebebbbebbbeeeeeeeeeebeeeeeebebeebeeeeebbbbbebbbeeeebebbeebeebeb:    
Contact         :        b                 b                                                                         

queryA       313:TPWTE: 317
                :*****:
5fuc_D_1     222:TPWTE: 226
SecStr          :     :    
ExpBur          :ebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123