Protein Model on 5njd_A_1_V_1 (TEMPLATE: 5njd )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) A 1 (A) polymer(polypeptide(L)) [298 aa] Interleukin-12 subunit beta :IL12B_HUMAN
2 b V 1 (V) polymer(polypeptide(L)) [205 aa] Briakinumab FAb Heavy chain 107H(D) 200S(K) (identity: 0.0 %/27.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5njd_A_1 identity=27.0%
queryA        39:PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG--------------TVHLLVD--VPPEEPQLSCF: 122
                :**  * ***    **      * *         *   * *  *        * * * *   *                      * *   *     * * :
5njd_A_1      42:PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCE: 132
SecStr          :  EEEEEE   --S  SS- EEEE------TTEEEEEEESSEEEEEE SGGG EEEEEEETTEEEEEEEEEEEEEETTEE   SB    SSSSS   EEE:    
ExpBur          :eeeebebebeb--eeeee-bebbb------eeeeeeebeeeebebebeeeeebbebbbbbeeeeebebebbbbbeeeeeebeebbeeeeeeeeebbbbbe:    
Contact         :                                                                         b bb     b                 

queryA       123:RKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ: 206
                : *       * *                *       *  *  *                 ** * *  *   * *    *  *  *  *         * :
5njd_A_1     133:AKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEESLPIEVMVDAVHKLKYENYTS: 225
SecStr          :BSSSSSEEEEEEEES  SSEEEEEEEEE SSS EEEEE   EEEEEEEETTEEEE----EEEEEEEESS---  TTS   S EEEEEEEEETTEEEEEEE:    
ExpBur          :bebbebebebebbbebeeebebebebbbbeeeeeebebeeeeeeeeeeeeeeebb----bbebebebee---eeeeeebeeebebebbbbbeebbbebee:    
Contact         :                                                                                             b      

queryA       207:TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS: 304
                : *    *  **** *              * *  *  *    *   * *                  *     **             ***       **:
5njd_A_1     226:SFFIRDIIKPDPPKNLQLKPLKXXXQ-VEVSWEYPDTWSTPHSYFSLTFCVQVQXXXXXEKKDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS: 320
SecStr          :EE HHHHB     EEEEEEE  --- -EEEEEE  SSS S TTTS EEEEEEE -----   EEEEESSSEEEE ----  TT EEEEEEEESSS     :    
ExpBur          :ebebeebbebeebeebeeeeee---e-bbbebebbeebbeeeeebbbbbbbbbe-----eebeeeebeeeeeebe----beeebebbbebbbeeeebeeb:    

queryA       305:EWS: 307
                :** :
5njd_A_1     321:EWA: 323
SecStr          :  E:    
ExpBur          :eeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123