Protein Model on 6o4p_A_1_C_1 (TEMPLATE: 6o4p )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) A 1 (A) polymer(polypeptide(L)) [295 aa] Interleukin-11 receptor subunit alpha :I11RA_HUMAN
2 b C 1 (C) branched(oligosaccharide) alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose 147V(L) 191S(N) 193C(T) 203S(T) 205T(L) (identity: 0.0 %/34.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6o4p_A_1 identity=34.7%
queryA        25:CPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLR-KPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA-GRPAGTVHLLVDVPPEEPQLSCF: 122
                :**      **    ** ** * ****   *   * *     *     *    * *  * *      * * * *    *   *** *    **  *  ** :
6o4p_A_1       4:CPQAWGPPGVQYGQPGRSVKLCCPGVTAGD--PVSWFRDGEPKLLQGPD--SGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSC-:  98
SecStr          :S   SSSTTEEEE TTS EEEE TT  SS -- EEEEETTB   SS GG--GSSTTEEEESS  TTT SEEEEEESSS EEEEEEEEE       EEEE-:    
ExpBur          :beeeeeeeebbbbbeeeebebbbeebeeee--ebbbebeeeeeeebeee--eeebbebebeebeeeeeeebebebeeeeeeeebebebbeebeebebeb-:    

queryA       123:RKSPLSNVVCEWGPRSTPSLTTKAVLLVRK--------FQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS--SFYIVSMCVASSVGSKFSKTQTFQGCG: 212
                :      *  * * *     * *      **           **      **              *  *    * *          *             :
6o4p_A_1      99:QAADYENFSCTWSPSQISGLPTRYLTSYRKKTVXXXXXXXXSPSTG-PWPC----PQDPLGAARCVVHGAEFWSQYRINVTEVNPLGAS-TRLLDVSLQS: 192
SecStr          :EESSSS EEEEEE SS   S  EEEEEEEE   --------     - EE ---- B STT SEEEE S  SSSEEEEEEEEEETTEEE-EEEEEEETTT:    
ExpBur          :ebebbeebbbebeeeeebebebebebebebeee--------eeeee-eeeb----eeeeeeeeebbbeebebebebebebbbebeeeeb-eeeeebebee:    
Contact         :                        b                                                     b b         b b       

queryA       213:ILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS-FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM: 311
                :** ****    *  *   ** *   *  * ** *     * * * **        *     *    ** **  ** * *   *      * ** ***** :
6o4p_A_1     193:ILRPDPPQGLRVESVPGYPRRLRASWTYPASWPSQPHFLLKFRLQYRPAQHPAWSTVEPAGLEE--VITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAW: 290
SecStr          :SB     EEEEEEEETTEEEEEEEEEE  TTS SS SS EEEEEEEEETT SS EEE  SSSEE--EES   TT  EEEEEEEEETT  S        EE:    
ExpBur          :ebebeebeebebeebeeeeeebebbbeebeebeeeeebebebebbbebeeeeeeeeeebeeeee--ebeebeeeeebbbebbbbbeeebeeebeebeebe:    

queryA       312:GTP: 314
                :***:
6o4p_A_1     291:GTP: 293
SecStr          :E  :    
ExpBur          :beb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123