Protein Model on 6o4p_B_1_P_1 (TEMPLATE: 6o4p )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) B 1 (B) polymer(polypeptide(L)) [285 aa] Interleukin-11 receptor subunit alpha :I11RA_HUMAN
2 b P 1 (B) non-polymer(SO4) SULFATE ION 295Q(R) (identity: 0.0 %/35.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6o4p_B_1 identity=35.3%
queryA        25:CPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLR-KPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA-GRPAGTVHLLVDVPPEEPQLSCF: 122
                :**      **    ** ** * ****   *   * *     *     *    * *  * *      * * * *    *   *** *    **  *  ** :
6o4p_B_1       4:CPQAWGPPGVQYGQPGRSVKLCCPGVTAGD--PVSWFRDGEPKLLQGPD--SGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSC-:  98
SecStr          :S   SSSTTEEEE TTS EEEE TTS SS -- EEEEETTEEEESS GG--GSSTTEEEESS  TTT EEEEEEESSSSEEEEEEEEE       EEEE-:    
ExpBur          :beeeeeeeebbbbeeeeebebbbeebeeee--ebbbeeeeeeeeebeee--eeebbebebeebeeeeeeebebeeeeeeeebebebebbeebeebebeb-:    

queryA       123:RKSPLSNVVCEWGPRSTPSLTTKAVLLVRK------------FQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQG: 210
                :      *  * * *     * *      **                *    * *           *     *  *   *    *     *        * :
6o4p_B_1      99:QAADYENFSCTWSPSQISGLPTRYLTSYRKKTVXXXXXXXXXXSTGPWPCPQDPLGAAR------CVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQS: 192
SecStr          :EESSSS EEEEEE SS   S  EEEEEEEES  ----------    EE  B TTS SE------EEE S  TTSEEEEEEEEEETTEEEEEEEEEETTT:    
ExpBur          :ebbbbeebbbebeeeeebebebebebebebeee----------eeeeeebeebeeeeee------bbbeebeeebebebebbbebeeeebeeeeebebee:    

queryA       211:CGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS-FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE: 309
                :  ** ****    *  *   ** *   *  * ** *     * * * **        *     *    ** **  ** * *   *      * ** ****:
6o4p_B_1     193:--ILRPDPPQGLRVESVPGYPRRLRASWTYPASWPSQPHFLLKFRLQYRPAQHPAWSTVEPAGLEE--VITDAVAGLPHAVRVSARDFLDAGTWSTWSPE: 288
SecStr          :--SB     EEEEEEEETTEEEEEEEEEE  TTS SS SS EEEEEEEE TT S  EEE  SSSEE--EES   TT  EEEEEEEEETT  S        :    
ExpBur          :--ebebeebeebebeebeeeeeebebbbeebeebeeeeeeebebebbbbbeeeeeeeeeebeeeee--ebeebeeeeebbbbbbbbbeeebeeebeebee:    
Contact         :                                                                                     b              

queryA       310:AMGTP: 314
                :* ***:
6o4p_B_1     289:AWGTP: 293
SecStr          :EEE  :    
ExpBur          :bebeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123