Protein Model on 6uib_B_1_C_1 (TEMPLATE: 6uib )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) B 1 (B) polymer(polypeptide(L)) [274 aa] Interleukin-12 subunit beta :IL12B_HUMAN
2 b C 1 (C) polymer(polypeptide(L)) [15 aa] Peptide 23-652 252R(T) 270V(F) 271K(T) 272D 295Q 296E(D) 297E(R) 298F(Y) 299G(Y) 300Q(S) 301G(S) 303W (identity: 25.0 %/26.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6uib_B_1 identity=26.2%
queryA        39:PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY--------------RAGRPAGTVHLLVDVPPEEPQ--LSCF: 122
                :**  * ***            * *         *   * *  *        * * * *                          * *         * * :
6uib_B_1      24:PGEMVVLTC---DXXXXXXXXWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHXXXXXXXHSLLLLHKKEDGIWSTDILKDQXXXXNKTFLRCE: 114
SecStr          :  EEEEEE --- -------- EE------TT       SSEEEEEE SGGG EEEE  ------- EEEEEEEBSSSSB   SS   ----     EEE:    
ExpBur          :eeeebebee---e--------bbb------eeeeeeeeeeeebebebbeeeebbebeee-------ebebbbbeeeeeeebeebbeee----eeebbebe:    

queryA       123:RKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ: 206
                : *       * *                *       *  *  *                 ** * *  *   * *    *  *  *  *         * :
6uib_B_1     115:AKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVXXXXXEYE----YSVECQEDS---ACPAAEESLPIEVMVDAVHKLKYENYTS: 207
SecStr          :BSSSSSEEEEEEEES  SSEEEEEEEEE SSS EEEEE   EEEEE  ----- EE----EEEEEEETT---  TTS   S EEEEEEEEETTEEEEEEE:    
ExpBur          :bebbebebbbbbbbebeeebebebebbbbeeeeeebebeeeeeebeee-----eeb----bbbebebee---eeeeeebeeebbbebebbbeeebbebee:    

queryA       207:TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS: 304
                : *    *  **** *        * *   * *  *  *    *   * *                  *     **             ***       **:
6uib_B_1     208:SFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKXXKKDRVFTDKTSATVI----CRKXXSISVRAQDRYYSSSWS: 302
SecStr          :EE GGGGB     EEEEEEE -TTSSEEEEEEE  TTS S TTTS EEEEEEE  S  --  EEEEESSSEEEEE----   -- EEEEEEESSS     :    
ExpBur          :ebebbebbbbeebeebeeeee-eeeeebbbebebbeebbeeeeebbbbbbbbbeeeee--eeeeeebeeeebebe----bee--ebbbebbbeeeebeeb:    
Contact         :                                               b                 bbb                      bbbbbbb b 

queryA       305:EWS: 307
                :** :
6uib_B_1     303:EWA: 305
SecStr          :  E:    
ExpBur          :eeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123