#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2fe8 assembly_id=6

Protein Model on 2fe8 assembly_id=6 (TEMPLATE: 2fe8 assembly_id:6 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [315 aa] Replicase polyprotein 1ab :R1AB_CVHSA
2 b A 2 (A) polymer(polypeptide(L)) [315 aa] Replicase polyprotein 1ab :R1AB_CVHSA
3 c B 1 (B) polymer(polypeptide(L)) [314 aa] Replicase polyprotein 1ab :R1AB_CVHSA 1591G 1592Q 1593Q 1594F 1595G 1596P 1598Y 1603D 1605T 1606K 1621L 1623N(S) 1639D 1640P(E) 1641S 1644G 1672N 1828T 1829G 1831Y 1832Q 1847C(R) 1849D (identity: 87.0 %/82.8 %)
4 d B 2 (B) polymer(polypeptide(L)) [314 aa] Replicase polyprotein 1ab :R1AB_CVHSA 1564E 1565V 1566R(K) 1567T 1568I 1586M 1611N(V) 1614E (identity: 75.0 %/82.8 %)
5 e D 1 (A) non-polymer(ZN) ZINC ION 1752C 1755C 1787C 1789C (identity: 100.0 %/82.8 %)
6 f D 2 (A) non-polymer(ZN) ZINC ION
7 g E 1 (A) non-polymer(BR) BROMIDE ION 1821F 1822T(L) 1868Y 1869K (identity: 75.0 %/82.8 %)
8 h E 2 (A) non-polymer(BR) BROMIDE ION
9 i F 1 (A) non-polymer(BR) BROMIDE ION 1689K 1690F 1696Q (identity: 100.0 %/82.8 %)
10 j F 2 (A) non-polymer(BR) BROMIDE ION
11 k G 1 (A) non-polymer(BR) BROMIDE ION 1648S 1649A 1721T 1722V (identity: 100.0 %/82.8 %)
12 l G 2 (A) non-polymer(BR) BROMIDE ION
13 m H 1 (A) non-polymer(SO4) SULFATE ION 1636H 1691N 1737Q 1738H (identity: 100.0 %/82.8 %)
14 n H 2 (A) non-polymer(SO4) SULFATE ION
15 o I 1 (B) non-polymer(ZN) ZINC ION
16 p I 2 (B) non-polymer(ZN) ZINC ION
17 q J 1 (B) non-polymer(BR) BROMIDE ION
18 r J 2 (B) non-polymer(BR) BROMIDE ION
19 s K 1 (B) non-polymer(BR) BROMIDE ION
20 t K 2 (B) non-polymer(BR) BROMIDE ION
21 u L 1 (B) non-polymer(BR) BROMIDE ION
22 v L 2 (B) non-polymer(BR) BROMIDE ION
23 w M 1 (B) non-polymer(SO4) SULFATE ION
24 x M 2 (B) non-polymer(SO4) SULFATE ION
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2fe8_A_1 identity=82.8%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :** ********** ***** ***************************  ****** *** ***** ******** * ***************** *** *:
2fe8_A_1       2:EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGG: 101
SecStr          :   EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TT    GGGTT EEEE   SHHHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebebbbbeeeeeeeebbeeebbeeebeebbbebeebeeeebeeebeeeebbbbbeeeebeebbeebbebeeeebbbebbebbeebeebebeebee:    
Contact         :ddddd                 d    cccccc c    c cc    d  d      c c            m  ccc  c   kk              

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :*************   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** :
2fe8_A_1     102:LTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLT: 201
SecStr          :EE     TTTHHHHHHHHHHHTS   BSSHHHHHHHHHHHHT  HHHHHHHHHHTT  TTS   HHHHHHHHHTTB  TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeebebbbbbbbbbbbbebebeeeeebeebbbebbeebebeebebbbbeebeeeeeeeeeee:    
Contact         :        c                iim    i                        kk              mm             e  e        

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :*************   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** :
2fe8_A_1     202:GVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV: 301
SecStr          :THHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEES GGG EEEEEEESSSEEEEETTEEEEESEEEEEE:    
ExpBur          :ebebbbeeebbbbeebeeeeebebeeeeebebebbebebebbbbbbeeeeeebeeeebebbbbeeeeeeebebbbbbeeebbbebebeeeeebeebebbb:    
Contact         :                       e e                               gg     cc cc              c c              

queryA      1864:TDVFYKENSYTTTI:1877
                :******* ******:
2fe8_A_1     302:TDVFYKETSYTTTI: 315
SecStr          :EEEEEE SEEE   :    
ExpBur          :bbbbbebeeeeeee:    
Contact         :    gg                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123