Protein Model on 2jgz_A_1_B_1 (TEMPLATE: 2jgz )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A) b(query B)
1 a A(CDK5_HUMAN) A 1 (A) polymer(polypeptide(L)) [289 aa] CELL DIVISION PROTEIN KINASE 2 :CDK2_HUMAN 167C 169E 170Y 171V 173D 174I 175Y 177Y 178L 181L 219L 221E 253F 257K 258Y 259E 260E 261M 265E 266I 283R 286E 287M 290L 291R 295F 296G 297L 298G (identity: 100.0 %/100.0 %)
2 b B(CCNB1_HUMAN) B 1 (B) polymer(polypeptide(L)) [260 aa] G2/MITOTIC-SPECIFIC CYCLIN-B1 :CCNB1_HUMAN 40D(E) 41D(T) 42E 43G 44V 46S 49L(I) 50R 52I 53C(S) 57E 69V 71H 115G(A) 118H 119S 120R(H) 121N(R) 149R 150A 151F 153I(V) 156R 157C(T) 158Y 159S(U) 272V(N) 276S 277A 278E(K) (identity: 60.0 %/61.2 %)
ALIGNMENTS
MODEL[1] Protein A "CDK5_HUMAN" TEMPLATE:2jgz_A_1 identity=61.2%
CDK5_HUMAN     1:MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDP: 100
                :*    * ********* * ** *  * * ****  ***   ***** * *** ***** * *** * ** *   ** *****  *****  *       *:
2jgz_A_1       2:MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIP: 101
SecStr          : TTEEEEEEEEE SSSEEEEEEETTT  EEEEEEEESSS TTSS HHHHHHHHHHHH   TTB  EEEEEEETTEEEEEEE  SEEHHHHHHHTTTS   :    
ExpBur          :beebeeeeeeeebeeeebbebebeeeeeebbbbbbeeeeeeeeebebbeebbebbeebebebbbebeeebeeeeebbbbbbebeebbeeebeebeeeebe:    
Contact         :                                       bbbbb b  bb bb   b           b b                             

CDK5_HUMAN   101:-EIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAG: 199
                :    ** ***** ** ****  **************  *  ************ *** *  ******** *  * * * ***  * ** ******     :
2jgz_A_1     102:LPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYUHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTR-: 200
SecStr          :HHHHHHHHHHHHHHHHHHHTTTEE    SGGGEEE TTS EEE   TT EE  SS     SS S GGG  HHHHTT S   THHHHHHHHHHHHHHHHS-:    
ExpBur          :eeebeebbebbbebbbebbeeebbbbbbbbebbebbeeebbbbbbbbebbebeeebeebeeebbebebbbbbbbbebeebeebbbbbbbbbbbbbbbbe-:    
Contact         :               b  bbbb                           bbb b  bbbb                                        

CDK5_HUMAN   200:RPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKP-YPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSD: 288
                :* ****    *** **** **** *  **  *  *****  *   *      *** *   ** **   *   *  ****  ** ** * *:
2jgz_A_1     201:RALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKW-ARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQD: 289
SecStr          :S S   SSHHHHHHHHHHHH    TTTSTTGGGSTT  TT    -    HHHHSTT  HHHHHHHHHTT SSTTTS  HHHHTT GGG  :    
ExpBur          :ebbbebeeeeebbeebbebbbbbeeeebeebeebeebeeebeee-eeeebeebbeebeeebeebbbebbebbeeebbebeebeebebbee:    
Contact         :                                                                         b   bbb                    

MODEL[2] Protein B "CCNB1_HUMAN" TEMPLATE:2jgz_B_1 identity=100.0%
CCNB1_HUMAN  167:CSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEI: 266
                :****************************************************************************************************:
2jgz_B_1       1:CSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEI: 100
SecStr          :  S HHHHHHHHHHHHHHT   TTTTTTSSS HHHHHHHHHHHHHHHHHHT  HHHHHHHHHHHHHHHTTS   GGGHHHHHHHHHHHHHHHH SS   H:    
ExpBur          :eeeeeeeebeebeebbeebebeeebbeeeebeeeebbebbbbbbebbeeeebebbbbbbbbbbbbbbbbeeebeeeebebbbbbbbbbbbeeebeeebeb:    
Contact         :a aaa aaa aa  a                                     a a                               a   aaaaa   aa

CCNB1_HUMAN  267:GDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQ: 366
                :****************************************************************************************************:
2jgz_B_1     101:GDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQ: 200
SecStr          :HHHHHHTTTSS HHHHHHHHHHHHHHHTT      HHHHHHHHHHSS   HHHHHHHHHHHHHHTT GGGTTS HHHHHHHHHHHHHHHSS     HHHH:    
ExpBur          :eebbebbeeebeeeebeebbeebbeebeeebebbbbbebbebbbeeeeeeeebebbbebbbbbbbbbbebbebebbbbbbbbbbbbbebbeeeebeeebe:    
Contact         :                a  aa  aa   aaaa                                                                    

CCNB1_HUMAN  367:HYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDL: 426
                :************************************************************:
2jgz_B_1     201:HYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDL: 260
SecStr          :HHS   HHHHHHHHHHHHHHHHHHHTT  S  HHHHHTTSGGGTTGGGSS  SSS     :    
ExpBur          :eebebeeeebeebbebbbbbbeebbeeeeebebbbebbeeeebeebbeeebeeeebebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123