#WARNING:Can't open blastfile '/var/www/html/homcos_out/TMPOUT/37296.bltA' #WARNING:Can't open blastfile '/var/www/html/homcos_out/TMPOUT/37296.psiA'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
37296 38 0 A0A663DJA2(A0A663DJA2_SARS2) SubName: Full=ORF10 proteiin {ECO:0000313|EMBL:QHZ00366.1};SubName: Full=ORF10 protein {ECO:0000313|EMBL:QHI42199.1, ECO:0000313|EMBL:QHS34554.1};
QUERYSEQ
MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [A0A663DJA2(A0A663DJA2_SARS2)]

38
region name description

No homologue is found in PDB.

Please check [SiteTable] for homologues.