[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
56501 492 500 O15393(TMPS2_HUMAN) RecName: Full=Transmembrane protease serine 2 {ECO:0000305}; EC=3.4.21.-;AltName: Full=Serine protease 10 {ECO:0000305};Contains: RecName: Full=Transmembrane protease serine 2 non-catalytic chain;Contains: RecName: Full=Transmembrane protease serine 2 catalytic chain;Flags: Precursor;
QUERYSEQ
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVR
LYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK
PLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKN
NIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [O15393(TMPS2_HUMAN)]

492
region name description
1-255 CHAIN /note="Transmembrane protease serine 2 non-catalytic chain" /id="PRO_0000027855"
256-492 CHAIN /note="Transmembrane protease serine 2 catalytic chain" /id="PRO_0000027856"
1-84 TOPO_DOM /note="Cytoplasmic"
85-105 TRANSMEM /note="Helical; Signal-anchor for type II membrane protein"
106-492 TOPO_DOM /note="Extracellular"
112-149 DOMAIN /note="LDL-receptor class A"
150-242 DOMAIN /note="SRCR"
256-489 DOMAIN /note="Peptidase S1"
296-296 ACT_SITE /note="Charge relay system"
345-345 ACT_SITE /note="Charge relay system"
441-441 ACT_SITE /note="Charge relay system"
1-492 DISORDER predicted by DISOPRED (1-35,48-48,50-70,492-492)

MONOMER
492
pdb_id a1 identity[%]2 description
6kd5 B 47.0 TMPSD_HUMAN Transmembrane protease serine 13 (Peptidase S1 domain)
1z8g A 35.2 HEPS_HUMAN Serine protease hepsin
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
492 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6kd5[1] A TMPSD_HUMAN Transmembrane protease serine 13[131 aa] B 42.9
/47.0
42
/45
TMPSD_HUMAN Transmembrane protease serine 13 (Peptidase S1 dom..
6kd5[1] C DECANOYL-ARG-VAL-LYS-ARG-CHLOROMETHYLKETONE INHIBI.. B 75.0
/47.0
20
/20
TMPSD_HUMAN Transmembrane protease serine 13 (Peptidase S1 dom..
6hhc[1] B FXIA ANTIBODY FAB HEAVY CHAIN[214 aa] C 50.0
/44.8
10
/13
FA11_HUMAN Coagulation factor XI
6hhc[1] A FXIA ANTIBODY FAB LIGHT CHAIN[213 aa] C 16.7
/44.8
6
/7
FA11_HUMAN Coagulation factor XI
6twb[1] C Double Bridged Peptide F19[11 aa] A 61.9
/44.5
21
/21
FA11_HUMAN Coagulation factor XI
4x6n[4] B cleaved peptide[7 aa] A 40.0
/44.5
10
/10
FA11_HUMAN Coagulation factor XI, light chain
5q0f[1] B MET-ASP-ASP-ASP-ASP-LYS-MET-ASP-ASN-GLU-CYS-THR-TH.. A 45.5
/44.5
11
/11
FA11_HUMAN Coagulation factor XI
5qtx[1] B FA11_HUMAN Coagulation factor XI[6 aa] A 45.5
/44.5
11
/11
FA11_HUMAN Coagulation factor XI
6twc[1] B FA11_HUMAN Coagulation factor XI[8 aa] A 40.0
/44.5
10
/10
FA11_HUMAN Coagulation factor XI
6twc[1] C Double Bridged Peptide F21[12 aa] A 63.6
/44.5
22
/22
FA11_HUMAN Coagulation factor XI
1fiw[1] B BETA-ACROSIN LIGHT CHAIN[14 aa] A 38.1
/44.2
21
/24
ACRO_SHEEP BETA-ACROSIN HEAVY CHAIN
4ogy[2] C DX-2930 HEAVY CHAIN[219 aa] A 53.6
/44.0
28
/30
KLKB1_HUMAN Plasma kallikrein
1xx9[6] D ECOT_ECOLI Ecotin[139 aa] B 53.3
/45.5
30
/30
FA11_HUMAN Coagulation factor XI
1xxf[6] D ECOT_ECOLI Ecotin[138 aa] A 21.4
/44.1
14
/14
FA11_HUMAN Coagulation factor XI
4o97[3] B ST14_HUMAN Peptide CGLR[4 aa] A 54.5
/44.0
11
/11
ST14_HUMAN Suppressor of tumorigenicity 14 protein
3p8f[1] B SFTI1_HELAN Trypsin inhibitor 1[14 aa] A 65.2
/44.0
23
/23
Q8WVC1_HUMAN ST14 protein
1yc0[1] B SPIT1_HUMAN Kunitz-type protease inhibitor 1[66 aa] A 56.0
/38.2
25
/25
HGFA_HUMAN Hepatocyte growth factor activator
4isl[3] A SPIT1_HUMAN Kunitz-type protease inhibitor 1[60 aa] B 57.1
/43.6
28
/29
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4ogy[1] E DX-2930 HEAVY CHAIN[200 aa] B 63.2
/44.0
19
/19
KLKB1_HUMAN Plasma kallikrein
5f8x[1] B CYS-PRO-ALA-ARG-PHE-M70-ALA-LEU-TRP-CYS[10 aa] A 47.4
/44.0
19
/19
KLKB1_HUMAN Plasma kallikrein
5f8t[1] B CYS-PRO-LYS-ARG-PHE-M70-ALA-LEU-PHE-CYS[10 aa] A 50.0
/44.0
18
/18
KLKB1_HUMAN Plasma kallikrein light chain
5f8z[1] B CYS-PRO-ALA-ARG-PHE-M70-ALA-LEU-PHE-CYS[10 aa] A 56.2
/44.0
16
/16
KLKB1_HUMAN Plasma kallikrein LIGHT CHAIN
3nps[1] C S4 FAB LIGHT CHAIN[211 aa] A 20.0
/43.6
5
/7
ST14_HUMAN Suppressor of tumorigenicity 14 protein
3nps[1] B S4 FAB HEAVY CHAIN[226 aa] A 68.4
/43.6
19
/20
ST14_HUMAN Suppressor of tumorigenicity 14 protein
3bn9[1] F E2 Fab Heavy Chain[224 aa] D 42.9
/43.6
21
/22
ST14_HUMAN Membrane-type serine protease 1
2wuc[2] E FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN[214 aa] A 28.6
/38.2
7
/7
HGFA_HUMAN HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
4ogy[3] D DX-2930 LIGHT CHAIN[212 aa] A 60.0
/44.0
5
/5
KLKB1_HUMAN Plasma kallikrein
6aod[1] A FXIa Antibody FAB Light Chain[207 aa] C 46.2
/43.4
26
/26
FA11_HUMAN Coagulation factor XI
3bn9[2] E E2 Fab Light Chain[211 aa] D 0.0
/43.6
3
/3
ST14_HUMAN Membrane-type serine protease 1
3bn9[1] C E2 Fab Heavy Chain[211 aa] A 43.5
/43.6
23
/24
ST14_HUMAN Membrane-type serine protease 1
6a8o[1] C peptide inhibitor,[10 aa] B 57.1
/43.5
14
/14
KLKB1_MOUSE Plasma kallikrein
6a8o[1] C peptide inhibitor,[10 aa] A 25.0
/43.5
4
/4
KLKB1_MOUSE Plasma kallikrein
6aod[1] B FXIa Antibody FAB Heavy Chain[211 aa] C 16.7
/43.4
6
/7
FA11_HUMAN Coagulation factor XI
1o5f[3] A HEPS_HUMAN Serine protease hepsin[110 aa] B 33.3
/43.2
30
/30
HEPS_HUMAN Serine protease hepsin
2f91[1] B SGP1_SCHGR Serine protease inhibitor I/II[33 aa] A 59.3
/43.0
27
/28
Q52V24_PONLE hepatopancreas trypsin
6r8x[1] C anti-Factor-XI Fab fragment heavy chain MAA868[219.. A 40.0
/42.9
15
/15
FA11_HUMAN Coagulation factor XI
6r8x[1] B anti-Factor-XI Fab fragment light chain MAA868[211.. A 0.0
/42.9
7
/7
FA11_HUMAN Coagulation factor XI
1fiz[2] B ACRO_PIG BETA-ACROSIN LIGHT CHAIN[13 aa] A 38.1
/42.9
21
/24
ACRO_PIG BETA-ACROSIN HEAVY CHAIN
1ekb[1] C VAL-ASP-ASP-ASP-ASP-LYK PEPTIDE[5 aa] B 84.6
/42.5
13
/13
ENTK_BOVIN ENTEROPEPTIDASE
1ekb[1] A ENTK_BOVIN ENTEROPEPTIDASE[7 aa] B 69.2
/42.5
13
/13
ENTK_BOVIN ENTEROPEPTIDASE
3so3[1] C A11 FAB heavy chain[220 aa] A 52.9
/42.5
17
/18
ST14_HUMAN Suppressor of tumorigenicity 14 protein
3so3[1] B A11 FAB light chain[216 aa] A 40.0
/42.5
10
/10
ST14_HUMAN Suppressor of tumorigenicity 14 protein
1mct[1] B ITRA_MOMCH TRYPSIN INHIBITOR A[28 aa] A 76.2
/42.3
21
/22
TRYP_PIG BETA-TRYPSIN
4doq[1] B SLPI_HUMAN Antileukoproteinase[47 aa] A 59.1
/42.3
22
/23
TRYP_PIG Trypsin
5xwj[4] D Acetylated-THR-ARG-GLU Inhibitor[3 aa] C 93.3
/42.1
15
/15
TRYP_PIG Trypsin
2sta[1] B ITR1_CUCMA PROTEIN (TRYPSIN INHIBITOR)[29 aa] A 84.2
/42.1
19
/19
TRY1_SALSA PROTEIN (TRYPSIN)
2stb[1] B ITR3_CUCPE PROTEIN (TRYPSIN INHIBITOR)[29 aa] A 75.0
/42.1
20
/20
TRY1_SALSA PROTEIN (TRYPSIN)
1tx6[4] F IBB_HORVU Bowman-Birk type trypsin inhibitor[114 aa] D 75.0
/41.9
20
/21
TRYP_PIG Trypsin
1h9i[1] B ITR2_ECBEL TRYPSIN INHIBITOR II[30 aa] A 76.2
/41.9
21
/22
TRYP_PIG TRYPSIN
4an7[1] B F4ZZG4_TAMIN TRYPSIN INHIBITOR[156 aa] A 73.9
/41.9
23
/24
TRYP_PIG TRYPSIN
1tfx[2] C TFPI1_HUMAN TISSUE FACTOR PATHWAY INHIBITOR[58 aa] A 77.8
/41.9
18
/19
TRYP_PIG TRYPSIN
1v6d[1] B PD(AIB)L(AIB)LA[7 aa] A 25.0
/41.9
4
/4
TRYP_PIG Trypsin
1an1[2] B LDTI_HIRME TRYPTASE INHIBITOR[40 aa] A 78.9
/41.6
19
/20
TRYP_PIG TRYPSIN
1avw[2] B ITRA_SOYBN TRYPSIN INHIBITOR[171 aa] A 70.8
/41.9
24
/25
TRYP_PIG TRYPSIN
6o1f[1] C ITRA_SOYBN Trypsin inhibitor A[177 aa] A 51.6
/40.3
31
/34
TRYB1_HUMAN Tryptase alpha/beta-1
3myw[2] B IBB_PHAAU Bowman-Birk type trypsin inhibitor[55 aa] A 72.7
/41.9
22
/23
TRYP_PIG Trypsin
1z7k[1] B IOVO_MELGA Ovomucoid[62 aa] A 65.2
/41.9
23
/24
TRYP_PIG Trypsin
1yf4[1] B Vasopressin[10 aa] A 69.6
/41.9
23
/23
TRYP_PIG Trypsin
1c9p[2] B BDEL_HIRME BDELLASTASIN[50 aa] A 77.8
/41.6
18
/19
TRYP_PIG TRYPSIN
1p2n[12] B BPT1_BOVIN Pancreatic trypsin inhibitor[58 aa] C 0.0
/41.6
5
/5
CTRA_BOVIN Chymotrypsinogen A
1p2n[51] D BPT1_BOVIN Pancreatic trypsin inhibitor[58 aa] C 61.9
/41.6
21
/21
CTRA_BOVIN Chymotrypsinogen A
4bnr[2] D BPT1_BOVIN PANCREATIC TRYPSIN INHIBITOR[59 aa] B 68.2
/43.0
22
/23
Q52V24_PONLE HEPATOPANCREAS TRYPSIN
1gl1[2] E LCM_LOCMI PROTEASE INHIBITOR LCMI II[33 aa] B 66.7
/41.5
21
/21
CTRA_BOVIN ALPHA-CHYMOTRYPSIN
1cgi[2] B IPK1_HUMAN PANCREATIC SECRETORY TRYPSIN INHIBITOR (KAZAL TYPE.. A 50.0
/41.5
28
/29
CTRA_BOVIN ALPHA-CHYMOTRYPSINOGEN
1zr0[2] D TFPI2_HUMAN Tissue factor pathway inhibitor 2[63 aa] C 78.9
/41.4
19
/20
TRY1_BOVIN Cationic trypsin
1zjd[1] B A4_HUMAN Kunitz Protease Inhibitory Domain of Protease Nexi.. A 59.1
/43.7
22
/22
FA11_HUMAN Catalytic Domain of Coagulation Factor XI
1taw[2] B A4_HUMAN PROTEASE INHIBITOR DOMAIN OF ALZHEIMER'S AMYLOID B.. A 80.0
/41.4
20
/21
TRY1_BOVIN TRYPSIN
2y6t[4] H ECOT_YERPY ECOTIN[138 aa] C 25.0
/41.4
12
/12
CTRA_BOVIN CHYMOTRYPSINOGEN A
2y6t[4] H ECOT_YERPY ECOTIN[138 aa] D 57.7
/41.4
26
/26
CTRA_BOVIN CHYMOTRYPSINOGEN A
1acb[1] B ICIC_HIRME Eglin C[63 aa] A 66.7
/41.3
18
/19
CTRA_BOVIN ALPHA-CHYMOTRYPSIN
3t62[3] F ISH1_STOHE Kunitz-type proteinase inhibitor SHPI-1[54 aa] E 54.5
/41.3
22
/23
CTRA_BOVIN Chymotrypsinogen A
1oxg[1] B CTRA_BOVIN Chymotrypsinogen A[14 aa] A 68.8
/41.3
16
/16
CTRA_BOVIN Chymotrypsinogen A
5j4q[1] B IBB1_SOYBN Bowman-Birk type proteinase inhibitor[64 aa] A 54.2
/41.2
24
/24
CTRA_BOVIN Chymotrypsinogen A
1gl0[1] B LCM_LOCMI PROTEASE INHIBITOR LCMI I[32 aa] A 48.0
/41.2
25
/26
CTRA_BOVIN CHYMOTRYPSINOGEN A
5j4s[1] B IBB1_SOYBN Bowman-Birk type proteinase inhibitor[67 aa] A 60.9
/41.2
23
/23
CTRA_BOVIN Chymotrypsinogen A
1dlk[3] A CTRA_BOVIN Thrombin light chain[13 aa] B 42.1
/41.0
19
/19
CTRA_BOVIN Thrombin heavy chain
1dlk[3] E peptidic inhibitor[5 aa] B 71.4
/41.0
14
/14
CTRA_BOVIN Thrombin heavy chain
1dlk[2] E peptidic inhibitor[5 aa] D 0.0
/41.0
2
/2
CTRA_BOVIN Thrombin heavy chain
2wpi[10] A FA9_HUMAN COAGULATION FACTOR IXA LIGHT CHAIN[59 aa] C 28.6
/39.9
21
/21
FA9_HUMAN COAGULATION FACTOR IXA HEAVY CHAIN
2f9n[8] H Leupeptin[4 aa] D 85.7
/40.7
14
/14
TRYA1_HUMAN alpha I tryptase
2f9n[8] E Leupeptin[4 aa] D 0.0
/40.7
2
/2
TRYA1_HUMAN alpha I tryptase
6o1f[1] D Light Chain hu31A.v11[213 aa] A 12.5
/40.3
8
/8
TRYB1_HUMAN Tryptase alpha/beta-1
6o1f[1] B Heavy Chain hu31A.v11[217 aa] A 18.2
/40.3
11
/11
TRYB1_HUMAN Tryptase alpha/beta-1
6d40[1] B SFTI1_HELAN Trypsin inhibitor 1[14 aa] A 83.3
/40.1
18
/18
PLMN_HUMAN Plasminogen
6d3y[1] B SFTI1_HELAN Trypsin inhibitor 1[14 aa] A 78.9
/40.1
19
/19
PLMN_HUMAN Plasminogen
6d3x[2] C SFTI1_HELAN Trypsin inhibitor 1[14 aa] A 84.2
/40.1
19
/19
PLMN_HUMAN Plasminogen
1bui[1] C SAK_BPP42 Staphylokinase[122 aa] A 14.3
/40.1
14
/14
PLMN_HUMAN Plasminogen
1bui[1] C SAK_BPP42 Staphylokinase[122 aa] B 22.2
/40.1
9
/14
PLMN_HUMAN Plasminogen
3uir[2] C IVBI1_PSETT Textilinin-1[56 aa] A 89.5
/40.1
19
/19
PLMN_HUMAN Plasmin light chain B
5pau[63] A FA7_HUMAN Coagulation factor VII light chain[58 aa] B 38.1
/39.9
21
/22
FA7_HUMAN Coagulation factor VII heavy chain
1ygc[4] B FA7_HUMAN Coagulation factor VII[53 aa] A 0.0
/40.1
2
/3
FA7_HUMAN Coagulation factor VII
6q1u[2] C GLY-ARG-ALA-TYR-LYS-SER-LYS-PRO-PRO-ILE-ALA-PHE-PR.. A 82.4
/40.1
17
/17
PLMN_HUMAN Plasminogen
1dva[2] C PEPTIDE E-76[19 aa] A 0.0
/40.1
18
/20
FA7_HUMAN DES-GLA FACTOR VIIA (HEAVY CHAIN)
2ec9[3] D TF_HUMAN Tissue factor[116 aa] B 40.0
/40.1
5
/5
FA7_HUMAN Coagulation factor VII
2puq[1] D TRP-TYR-THR-ARG CHLOROMETHYLKETONE INHIBITOR[4 aa].. B 82.4
/40.1
17
/17
FA7_HUMAN Coagulation factor VII
1wss[39] A FA7_HUMAN Coagulation factor VII[142 aa] B 36.4
/40.1
22
/23
FA7_HUMAN Coagulation factor VII
1o5d[5] C TF_HUMAN Tissue factor[151 aa] B 20.0
/40.1
10
/10
FA7_HUMAN Coagulation factor VII
3ela[2] C TF_HUMAN Tissue factor[191 aa] B 27.3
/40.5
11
/11
FA7_HUMAN Coagulation factor VIIA heavy chain
3th3[1] C TF_HUMAN Tissue factor[154 aa] B 22.2
/40.1
9
/9
FA7_HUMAN Coagulation factor VII heavy chain
1j9c[24] A TF_HUMAN Tissue factor[210 aa] C 20.0
/40.1
10
/10
FA7_HUMAN factor VIIa heavy chain
1dan[3] C TF_HUMAN SOLUBLE TISSUE FACTOR[75 aa] B 0.0
/40.1
5
/5
FA7_HUMAN BLOOD COAGULATION FACTOR VIIA heavy chain
1l4d[2] B STRP_STREQ STREPTOKINASE[112 aa] A 50.0
/39.9
16
/17
PLMN_HUMAN PLASMINOGEN
1l4d[4] B STRP_STREQ STREPTOKINASE[112 aa] A 21.4
/39.9
14
/16
PLMN_HUMAN PLASMINOGEN
1l4z[2] B STRP_STREQ Streptokinase[125 aa] A 33.3
/39.9
6
/6
PLMN_HUMAN Plasminogen
1bml[2] D STRP_STREQ STREPTOKINASE[318 aa] B 6.1
/39.9
33
/35
PLMN_HUMAN PLASMIN
1bml[2] C STRP_STREQ STREPTOKINASE[318 aa] B 0.0
/39.9
4
/4
PLMN_HUMAN PLASMIN
6d3z[1] B SFTI1_HELAN Trypsin inhibitor 1[14 aa] A 70.0
/39.6
20
/20
PLMN_HUMAN Plasminogen
2wpk[5] B D-PHE-PRO-ARG-CHLOROMETHYL KETONE[3 aa] C 81.2
/39.5
16
/16
FA9_HUMAN COAGULATION FACTOR IXA HEAVY CHAIN
1fak[1] D BPT1_BOVIN PROTEIN (5L15)[55 aa] B 64.0
/38.9
25
/25
FA7_HUMAN PROTEIN (BLOOD COAGULATION FACTOR VIIA)
1fak[1] C TF_HUMAN PROTEIN (SOLUBLE TISSUE FACTOR)[183 aa] B 20.0
/38.9
10
/10
FA7_HUMAN PROTEIN (BLOOD COAGULATION FACTOR VIIA)
2wuc[1] C FAB FRAGMENT FAB40.DELTATRP HEAVY CHAIN[219 aa] A 23.1
/38.2
13
/14
HGFA_HUMAN HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
2r0l[1] B antibody heavy chain, Fab portion only[220 aa] C 20.0
/38.2
15
/16
HGFA_HUMAN Hepatocyte growth factor activator
2wuc[1] B HGFA_HUMAN HEPATOCYTE GROWTH FACTOR ACTIVATOR SHORT CHAIN[7 a.. A 27.3
/38.2
11
/11
HGFA_HUMAN HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
1z8g[1] B ACE-LYS-GLN-LEU-ARG-Chloromethylketone[6 aa] A 66.7
/35.2
21
/21
HEPS_HUMAN Serine protease hepsin
2wuc[1] D ACE-KQLR-CHLOROMETHYLKETONE INHIBITOR[6 aa] A 64.7
/38.2
17
/17
HGFA_HUMAN HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
2r0k[1] C antibody heavy chain of Fab58, Fab portion only[21.. A 33.3
/38.2
12
/14
HGFA_HUMAN Hepatocyte growth factor activator
2r0l[1] D HGFA_HUMAN Hepatocyte growth factor activator[10 aa] C 25.0
/38.2
12
/12
HGFA_HUMAN Hepatocyte growth factor activator
3t2n[2] C Antibody, Fab fragment, Heavy Chain[203 aa] A 25.0
/34.1
12
/12
HEPS_HUMAN Serine protease hepsin
3t2n[2] F Antibody, Fab fragment, Light Chain[212 aa] B 36.4
/34.8
11
/11
HEPS_HUMAN Serine protease hepsin
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
492 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1zpz[1] C BUK
N~2~-({[(1R)-1-(4-BROMOPHENYL)ETHYL]AMINO}CARBONYL..
A 68.4
/44.9
19
/19
FA11_HUMAN Coagulation factor XI
5tjx[1] B GBT
(8E)-3-amino-1-methyl-15-[(1H-pyrazol-1-yl)methyl]..
A 65.0
/44.7
20
/20
KLKB1_HUMAN Plasma kallikrein
4y8x[1] B 4GR
methyl (4-{4-chloro-2-[(1S)-1-({(2E)-3-[5-chloro-2..
A 72.0
/44.5
25
/25
FA11_HUMAN Coagulation factor XIa
2wuc[1] G NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 0.0
/38.2
1
/1
HGFA_HUMAN HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
5eod[2] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 33.3
/45.8
3
/3
FA11_HUMAN Coagulation factor XI
2f83[2] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/46.4
3
/3
FA11_HUMAN Coagulation factor XI
1ybw[2] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/38.6
3
/3
HGFA_HUMAN Hepatocyte growth factor activator precursor
2f9p[3] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/40.3
1
/1
Tryptase alpha-1
6o1g[1] B NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/44.7
1
/1
KLKB1_HUMAN Plasma kallikrein
5i25[3] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 33.3
/45.5
3
/3
FA11_HUMAN Coagulation factor XI
4x6p[2] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 20.0
/43.9
5
/5
FA11_HUMAN Coagulation factor XI, light chain
2wuc[1] F NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 0.0
/38.2
2
/2
HGFA_HUMAN HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
2f9n[2] O NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 33.3
/40.7
3
/3
TRYA1_HUMAN alpha I tryptase
5eok[1] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/45.8
1
/1
FA11_HUMAN Coagulation factor XI
4crb[2] D 7P0
N-[(1S)-1-benzyl-2-[2-[5-chloro-2-(tetrazol-1-yl)p..
A 70.8
/43.7
24
/24
FA11_HUMAN COAGULATION FACTOR XI
4y8y[1] B 4D5
methyl (4-{4-chloro-2-[(1S)-1-({(2E)-3-[5-chloro-2..
A 66.7
/44.5
24
/24
FA11_HUMAN Coagulation factor XIa
5qcm[1] B BVJ
methyl ~{N}-[4-[[(1~{S})-2-[(~{E})-3-[3-chloranyl-..
A 70.8
/44.5
24
/24
FA11_HUMAN Coagulation factor XI
5qcn[1] B BVM
4-[[(1~{S})-2-[(~{E})-3-[5-chloranyl-2-(1,2,3,4-te..
A 69.6
/44.5
23
/23
FA11_HUMAN Coagulation factor XI
5q0e[1] B 9FD
methyl [(4S,8S)-8-({(2E)-3-[5-chloro-2-(1H-tetrazo..
A 70.8
/44.5
24
/24
FA11_HUMAN Coagulation factor XI
6c0s[1] B EEJ
methyl (4-{6-[(1S)-2-[(3R)-1-acetylpiperidin-3-yl]..
A 72.0
/44.5
25
/25
FA11_HUMAN Coagulation factor XI
5qcl[1] B BUY
4-[[(1~{S})-2-[(~{E})-3-[5-chloranyl-2-(1,2,3,4-te..
A 72.0
/44.5
25
/25
FA11_HUMAN Coagulation factor XI
5qck[1] B BUV
4-[[(2~{S},3~{R})-1-[(~{E})-3-[5-chloranyl-2-(1,2,..
A 72.0
/44.5
25
/25
FA11_HUMAN Coagulation factor XI
5tkt[1] B 7DS
METHYL ((12E,15S)-15-(((2E)-3-(5-CHLORO-2-(1H-TETR..
A 69.6
/44.5
23
/23
FA11_HUMAN Factor XIa (Light Chain)
4wxi[1] B 3VM
trans-N-{(1S)-1-[4-(3-amino-2H-indazol-6-yl)pyridi..
A 70.0
/44.5
20
/20
FA11_HUMAN COAGULATION FACTOR XI, LIGHT CHAIN
4na8[1] B 1T6
5-aminocarbonyl-2-[3-[(2S,4R)-6-carbamimidoyl-4-me..
A 73.7
/44.5
19
/19
FA11_HUMAN Coagulation factor XI
4na7[1] B 1T5
3'-[(2S,4R)-6-carbamimidoyl-4-methyl-4-phenyl-1,2,..
A 73.7
/44.5
19
/19
FA11_HUMAN Coagulation factor XI
4ty7[1] B 39F
trans-N-{(1S)-1-[4-(3-amino-2H-indazol-6-yl)-5-chl..
A 70.0
/44.5
20
/20
FA11_HUMAN Coagulation factor XI
4ty6[1] C 39D
4-{2-[(1S)-1-({[trans-4-(aminomethyl)cyclohexyl]ca..
A 68.4
/44.5
19
/19
FA11_HUMAN Coagulation factor XI
5q0g[1] B 9F7
methyl [(3R,7S)-7-({(2E)-3-[5-chloro-2-(1H-tetrazo..
A 70.8
/44.5
24
/24
FA11_HUMAN Coagulation factor XI
5q0h[1] B 9F1
methyl [(4R,5E,8S)-11-chloro-8-[(2,6-difluoro-4-me..
A 73.7
/44.5
19
/19
FA11_HUMAN Coagulation factor XI
5q0f[1] C 9FA
methyl [(4R,5E,8S)-8-({(2E)-3-[5-chloro-2-(1H-tetr..
A 70.8
/44.5
24
/24
FA11_HUMAN Coagulation factor XI
5e2o[1] B 5JM
4-[(N-{(2E)-3-[5-chloro-2-(1H-tetrazol-1-yl)phenyl..
A 73.9
/44.5
23
/23
FA11_HUMAN Coagulation factor XIa light chain
5qtu[1] C QEV
methyl [(3R,7S)-7-{[1-(3-chloro-2-fluorophenyl)-5-..
A 73.9
/44.5
23
/23
FA11_HUMAN Coagulation factor XI
5qtt[1] B QEY
methyl [(3R,7S)-7-{[5-amino-1-(3-chloro-2-fluoroph..
A 72.7
/44.5
22
/22
FA11_HUMAN Coagulation factor XI
5q0d[1] B 9EY
methyl [(7S)-7-({(2E)-3-[5-chloro-2-(1H-tetrazol-1..
A 72.7
/44.5
22
/22
FA11_HUMAN Coagulation factor XI
5tku[1] B 7DK
METHYL ((15S)-15-(((2E)-3-(5-CHLORO-2-(1H-TETRAZOL..
A 72.7
/44.5
22
/22
FA11_HUMAN Factor XIa (Light Chain)
5tks[1] B 7DL
((15S)-18-CHLORO- 15-(((2E)-3-(5-CHLORO-2-(1H-TETR..
A 72.7
/44.5
22
/22
FA11_HUMAN Coagulation factor XI
5exm[1] B 5ST
methyl ~{N}-[4-[2-[(1~{S})-1-[[4-(aminomethyl)cycl..
A 70.0
/44.5
20
/20
FA11_HUMAN Coagulation factor XIa light chain
5exl[1] B 5SS
4-(aminomethyl)-~{N}-[(1~{S})-1-[4-(3-oxidanyl-1~{..
A 70.0
/44.5
20
/20
FA11_HUMAN Coagulation factor XIa light chain
6w50[1] B SWP
methyl ((10R,14S)-14-(4-(3-chloro-2,6-difluorophen..
A 75.0
/44.5
24
/24
FA11_HUMAN Coagulation factor XI
5qqp[1] B NR7
methyl [(5E,8S)-8-[(4S)-4-(3-chlorophenyl)-2-oxopi..
A 75.0
/44.5
20
/20
FA11_HUMAN Coagulation factor XI
5wb6[1] B 9ZM
methyl [(11S)-11-({(2E)-3-[5-chloro-2-(1H-tetrazol..
A 69.2
/44.5
26
/26
FA11_HUMAN Coagulation factor XI
4x6m[1] B 3Y3
1-{(1S)-1-[4-(3-amino-1H-indazol-6-yl)-5-chloro-1H..
A 75.0
/44.5
24
/24
FA11_HUMAN Coagulation factor XI, light chain
4x6n[1] C 3Y5
1-{(1S)-1-[4-(3-amino-1H-indazol-6-yl)-5-chloro-1H..
A 72.0
/44.5
25
/25
FA11_HUMAN Coagulation factor XI, light chain
4x6o[1] B 3Y4
methyl (4-{4-chloro-2-[(1S)-1-({3-[5-chloro-2-(1H-..
A 72.0
/44.5
25
/25
FA11_HUMAN Coagulation factor XI, light chain
4y8z[1] B 4CE
(2E)-N-[(1S)-1-[5-chloro-4-(4-hydroxy-2-oxo-1,2-di..
A 70.8
/44.5
24
/24
FA11_HUMAN Coagulation factor XIa
5qqo[1] C NRJ
methyl [(5E,8S)-8-[(6R)-6-(3-chlorophenyl)-2-oxo-1..
A 70.0
/44.5
20
/20
FA11_HUMAN Coagulation factor XI
5qtv[1] B QLS
methyl [(2R,7S)-7-({(2E)-3-[5-chloro-2-(1H-tetrazo..
A 72.7
/44.5
22
/22
FA11_HUMAN Coagulation factor XI
5qtw[1] B QLM
methyl (2R,7S)-7-({(2E)-3-[5-chloro-2-(1H-tetrazol..
A 69.6
/44.5
23
/23
FA11_HUMAN Coagulation factor XI
5qty[1] B QLJ
ethyl (2R,7S)-7-({(2E)-3-[5-chloro-2-(1H-tetrazol-..
A 66.7
/44.5
24
/24
FA11_HUMAN Coagulation factor XI
5qtx[1] C QLD
ethyl (2R,7S)-7-({(2E)-3-[5-chloro-2-(1H-tetrazol-..
A 66.7
/44.5
24
/24
FA11_HUMAN Coagulation factor XI
6t7p[1] O MU8
(2~{S},4~{R})-1-[[(3~{S})-3-azanyl-2,3-dihydro-1-b..
A 73.7
/44.4
19
/19
KLKB1_HUMAN Plasma kallikrein
6a8o[2] D MAN
alpha-D-mannopyranose[11 atoms]
A 33.3
/43.5
3
/3
KLKB1_MOUSE Plasma kallikrein
5gvt[2] F MAN
alpha-D-mannopyranose[11 atoms]
B 0.0
/44.3
1
/1
KLKB1_MOUSE Plasma kallikrein
4crg[3] F J4X
6-carbamimidoyl-N-phenyl-4-(pyrimidin-2-ylamino)na..
A 68.8
/44.2
16
/16
FA11_HUMAN COAGULATION FACTOR XI
3p8g[11] F BEN
BENZAMIDINE[9 atoms]
A 91.7
/44.0
12
/12
Q8WVC1_HUMAN ST14 protein
2zpq[4] H BEN
BENZAMIDINE[9 atoms]
B 91.7
/41.6
12
/12
Q8AV11_ONCKE Anionic trypsin
2oq5[1] B BEN
BENZAMIDINE[9 atoms]
A 75.0
/42.9
12
/12
TM11E_HUMAN Transmembrane protease, serine 11E
1bit[1] E BEN
BENZAMIDINE[9 atoms]
A 14.3
/41.2
7
/7
TRYPSIN
1zrk[1] E 367
3-HYDROXYPROPYL 3-[({7-[AMINO(IMINO)METHYL]-1-NAPH..
A 69.2
/44.1
13
/13
FA11_HUMAN Coagulation factor XI
3bg8[3] B INH
N-(R-CARBOXY-ETHYL)-ALPHA-(S)-(2-PHENYLETHYL)GLYCY..
A 85.7
/44.1
14
/14
FA11_HUMAN Coagulation factor XIa light chain
1zsl[1] B 624
2-(2-(3,4-DICHLOROPHENYL)-5-(ISOPROPYLAMINO)-6-OXO..
A 72.2
/44.1
18
/18
FA11_HUMAN Coagulation factor XI
5exn[1] C 5SU
methyl ~{N}-[4-[2-[(1~{S})-1-[[(~{E})-3-[5-chloran..
A 70.8
/44.1
24
/24
FA11_HUMAN Coagulation factor XIa light chain
4isn[8] D GSH
GLUTATHIONE[20 atoms]
B 57.1
/44.0
7
/7
ST14_HUMAN Suppressor of tumorigenicity 14 protein
1zhm[3] C GSH
GLUTATHIONE[14 atoms]
A 57.1
/44.1
7
/7
FA11_HUMAN coagulation factor XI
4o97[1] C NTX
N-(trans-4-aminocyclohexyl)-3,5-bis[(3-carbamimido..
A 68.8
/44.0
16
/16
ST14_HUMAN Suppressor of tumorigenicity 14 protein
2gv7[1] B 672
(S)-4-(4-(3-(3-CARBAMIMIDOYLPHENYL)-2-(2,4,6-TRIIS..
A 65.0
/44.0
20
/20
ST14_HUMAN Suppressor of tumorigenicity 14
4r0i[1] C 3KM
3-({(2S)-3-[4-(2-aminoethyl)piperidin-1-yl]-2-[(na..
A 73.3
/44.0
15
/15
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4o9v[1] C NT4
N-(trans-4-aminocyclohexyl)-3,5-bis(4-carbamimidoy..
A 72.2
/44.0
18
/18
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4jyt[1] B N4A
4,4'-[{3-[(naphthalen-2-ylsulfonyl)amino]pyridine-..
A 82.4
/44.0
17
/17
ST14_HUMAN Suppressor of tumorigenicity 14 protein
2gv6[1] B 730
(S)-3-(3-(4-(2-GUANIDINOETHYL)PIPERIDIN-1-YL)-2-(N..
A 75.0
/44.0
16
/16
ST14_HUMAN Suppressor of tumorigenicity 14
6n4t[1] E KD7
N-(3-phenylpropanoyl)-3-(1,3-thiazol-4-yl)-L-alany..
A 70.0
/44.0
20
/20
ST14_HUMAN Suppressor of tumorigenicity 14 protein
6n4t[1] F 144
TRIS-HYDROXYMETHYL-METHYL-AMMONIUM[8 atoms]
A 33.3
/44.0
3
/3
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4jzi[1] B N4C
N-(trans-4-aminocyclohexyl)-2,6-bis(4-carbamimidoy..
A 73.3
/44.0
15
/15
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4jz1[1] B F4D
4,4'-[(3-{[(4-fluorophenyl)sulfonyl]amino}pyridine..
A 78.9
/44.0
19
/19
ST14_HUMAN Suppressor of tumorigenicity 14 protein
5f8z[4] H MRZ
piperidine-1-carboximidamide[9 atoms]
A 90.0
/44.0
10
/10
KLKB1_HUMAN Plasma kallikrein LIGHT CHAIN
6o1g[1] D 7SD
N-[(6-amino-2,4-dimethylpyridin-3-yl)methyl]-1-({4..
A 70.6
/44.7
17
/17
KLKB1_HUMAN Plasma kallikrein
6o1s[1] D 7SD
N-[(6-amino-2,4-dimethylpyridin-3-yl)methyl]-1-({4..
A 65.0
/44.0
20
/20
KLKB1_HUMAN Plasma kallikrein
6ts7[1] B NWE
2-[2-[[3-(1,2,3,4-tetrahydroisoquinolin-7-yl)pheny..
A 86.7
/43.9
15
/15
FA11_HUMAN Coagulation factor XI
6vlv[1] D R3A
1-carbamimidamido-4-chloro-N-[(2R)-3-methyl-1-(mor..
A 70.6
/43.9
17
/17
FA11_HUMAN Coagulation factor XIa light chain
3sor[1] C O58
{4-[(N-{3-[5-chloro-2-(1H-tetrazol-1-yl)phenyl]pro..
A 68.2
/43.9
22
/22
FA11_HUMAN Coagulation factor XI
6ts6[1] H NW5
2-[2-[[3-[(3~{S})-3-azanyl-2,3-dihydro-1-benzofura..
A 76.5
/43.9
17
/17
FA11_HUMAN Coagulation factor XI
6ts5[1] B NW2
2-[2-[3-[(3~{S})-3-azanyl-2,3-dihydro-1-benzofuran..
A 72.2
/43.9
18
/18
FA11_HUMAN Coagulation factor XI
4crf[1] F R9B
N-[(1S)-1-benzyl-2-[(6-chloro-2-oxo-1H-quinolin-4-..
A 73.9
/43.9
23
/23
FA11_HUMAN COAGULATION FACTOR XI
3sos[1] D O61
N-[(2S)-1-({2-[5-chloro-2-(1H-tetrazol-1-yl)phenyl..
A 72.7
/43.9
22
/22
FA11_HUMAN Coagulation factor XI
6usy[1] B QGS
1-[(2S)-2-{3-[(3S)-3-amino-2,3-dihydro-1-benzofura..
A 76.5
/43.9
17
/17
FA11_HUMAN Coagulation factor XIa light chain
6vlu[1] C R2Y
N-cyclohexyl-D-leucyl-N-[(1-aminoisoquinolin-6-yl)..
A 66.7
/43.9
18
/18
FA11_HUMAN Coagulation factor XIa light chain
4x6p[2] D 3YU
(2E)-N-{(1S)-1-[4-(3-amino-1H-indazol-6-yl)-1H-imi..
A 73.9
/43.9
23
/23
FA11_HUMAN Coagulation factor XI, light chain
1zpb[1] C 995
4-METHYL-PENTANOIC ACID {1-[4-GUANIDINO-1-(THIAZOL..
A 72.2
/43.7
18
/18
FA11_HUMAN Coagulation factor XI
1zpc[1] E 716
2-[2-(3-CHLORO-PHENYL)-2-HYDROXY-ACETYLAMINO]-N-[4..
A 66.7
/43.7
18
/18
FA11_HUMAN Coagulation factor XI
1zml[1] I 412
(R)-1-(4-(4-(HYDROXYMETHYL)-1,3,2-DIOXABOROLAN-2-Y..
A 80.0
/43.7
15
/15
FA11_HUMAN Coagulation factor XI
1zsj[1] D 709
N-(7-CARBAMIMIDOYL-NAPHTHALEN-1-YL)-3-HYDROXY-2-ME..
A 69.2
/43.7
13
/13
FA11_HUMAN Coagulation factor XI
1zmj[1] D HDB
(R)-1-(4-(4-(HYDROXYMETHYL)-1,3,2-DIOXABOROLAN-2-Y..
A 80.0
/43.7
15
/15
FA11_HUMAN Coagulation factor XI
1ztk[1] D 62A
2-(5-AMINO-6-OXO-2-M-TOLYL-6H-PYRIMIDIN-1-YL)-N-[4..
A 80.0
/43.7
15
/15
FA11_HUMAN Coagulation factor XI
1zlr[1] E 368
(1R)-2-{[AMINO(IMINO)METHYL]AMINO}-1-{4-[(4R)-4-(H..
A 75.0
/43.7
16
/16
FA11_HUMAN Coagulation factor XI
1zsk[1] E 421
6-CARBAMIMIDOYL-4-(3-HYDROXY-2-METHYL-BENZOYLAMINO..
A 73.3
/43.7
15
/15
FA11_HUMAN Coagulation factor XI
1zmn[1] E 427
(R)-1-(4-(4-(HYDROXYMETHYL)-1,3,2-DIOXABOROLAN-2-Y..
A 85.7
/43.7
14
/14
FA11_HUMAN Coagulation factor XI
4cra[3] D XJ8
N-[(1S)-2-[(2-amino-5-quinolyl)methylamino]-1-benz..
A 66.7
/43.7
18
/18
FA11_HUMAN COAGULATION FACTOR XI
1zom[1] C 339
(S)-2-(3-((R)-1-(4-BROMOPHENYL)ETHYL)UREIDO)-N-((S..
A 66.7
/43.7
18
/18
FA11_HUMAN Coagulation factor XI
4cr5[2] B 0TU
6-chloroquinolin-2(1H)-one[12 atoms]
A 85.7
/43.7
14
/14
FA11_HUMAN COAGULATION FACTOR XIA
1ztl[1] D 737
N-[4-GUANIDINO-1-(THIAZOLE-2-CARBONYL)-BUTYL]-2-{6..
A 85.7
/43.7
14
/14
FA11_HUMAN Coagulation factor XI
1ztj[1] E 632
2-(5-BENZYLAMINO-2-METHYLSULFANYL-6-OXO-6H-PYRIMID..
A 70.6
/43.7
17
/17
FA11_HUMAN Coagulation factor XI
4cre[3] B MVN
6-chloro-4-methyl-1H-quinolin-2-one[13 atoms]
A 80.0
/43.7
15
/15
FA11_HUMAN COAGULATION FACTOR XI
4crc[1] B OTM
(2S)-2-[[(E)-3-[5-chloranyl-2-(1,2,3,4-tetrazol-1-..
A 77.3
/43.7
22
/22
FA11_HUMAN COAGULATION FACTOR XI
4cr9[2] B OTW
4-methylquinoline-2,6-diamine[13 atoms]
A 75.0
/43.7
12
/12
FA11_HUMAN COAGULATION FACTOR XI
2fda[1] E 682
N~2~-(AMINOCARBONYL)-N~1~-{4-{[AMINO(IMINO)METHYL]..
A 78.6
/43.7
14
/14
FA11_HUMAN Coagulation factor XI
3ncl[1] B CCZ
phenyl (4-carbamimidoylbenzyl)phosphonate[20 atoms..
A 87.5
/43.6
16
/16
ST14_HUMAN Suppressor of tumorigenicity 14 protein
5gvt[1] D BMA
beta-D-mannopyranose[11 atoms]
A 0.0
/43.5
1
/1
KLKB1_MOUSE Plasma kallikrein
5gvt[1] C BMA
beta-D-mannopyranose[11 atoms]
A 0.0
/43.5
1
/1
KLKB1_MOUSE Plasma kallikrein
4d7g[1] H E6U
N-[(1S)-1-benzyl-2-(3-guanidinopropylamino)-2-oxo-..
A 70.0
/43.4
20
/20
FA11_HUMAN COAGULATION FACTOR XIA
4d7f[1] C IXA
N-[(2S)-1-({4-[(diaminomethylidene)amino]butyl}ami..
A 72.7
/43.4
22
/22
FA11_HUMAN COAGULATION FACTOR XI
6ts4[1] K J7B
2-[2-[[3-[3-(aminomethyl)phenyl]phenyl]carbonylami..
A 75.0
/43.4
16
/16
FA11_HUMAN Coagulation factor XI
4d76[1] E J1J
N-[(2S)-1-({5-[(diaminomethylidene)amino]pentyl}am..
A 72.7
/43.4
22
/22
FA11_HUMAN COAGULATION FACTOR XI
4crd[3] B OTJ
Methyl N-[4-[5-chloro-2-[[3-[5-chloro-2-(tetrazol-..
A 72.7
/43.4
22
/22
FA11_HUMAN COAGULATION FACTOR XI
1o5e[1] C 132
6-CHLORO-2-(2-HYDROXY-BIPHENYL-3-YL)-1H-INDOLE-5-C..
B 82.4
/43.2
17
/17
HEPS_HUMAN Serine protease hepsin
1p57[1] C CR4
2-{5-[AMINO(IMINIO)METHYL]-1H-BENZIMIDAZOL-2-YL}BE..
B 83.3
/43.2
12
/12
HEPS_HUMAN Serine protease hepsin
1o5d[2] D CR9
2-{5-[AMINO(IMINIO)METHYL]-6-FLUORO-1H-BENZIMIDAZO..
B 82.4
/40.1
17
/17
FA7_HUMAN Coagulation factor VII
4doq[1] F XPE
3,6,9,12,15,18,21,24,27-NONAOXANONACOSANE-1,29-DIO..
A 28.6
/42.3
7
/7
TRYP_PIG Trypsin
1utl[1] B PRA
3-PHENYLPROPYLAMINE[10 atoms]
A 100.0
/42.1
11
/11
TRY1_SALSA TRYPSIN I
1utm[1] B PEA
2-PHENYLETHYLAMINE[9 atoms]
A 100.0
/42.1
6
/6
TRY1_SALSA TRYPSIN I
2a32[1] H CXS
3-CYCLOHEXYL-1-PROPYLSULFONIC ACID[14 atoms]
A 100.0
/41.9
1
/1
TRYP_PIG Trypsin
2a32[1] I CXS
3-CYCLOHEXYL-1-PROPYLSULFONIC ACID[14 atoms]
A 0.0
/41.9
2
/2
TRYP_PIG Trypsin
2a32[1] E PBC
PHENYL BORONIC ACID[8 atoms]
A 100.0
/41.9
4
/4
TRYP_PIG Trypsin
1s6h[1] F 4BZ
4-(HYDROXYMETHYL)BENZAMIDINE[11 atoms]
A 91.7
/41.9
12
/12
TRYP_PIG Trypsin
1s6f[1] E SBP
[3-(1,3,2-DIOXABOROLAN-2-YLOXY)PROPYL]GUANIDINE[13..
A 87.5
/41.9
16
/16
TRYP_PIG Trypsin
1s85[1] D SBZ
[4-(1,3,2-DIOXABOROLAN-2-YLOXY)METHYL]BENZAMIDINE[..
A 86.7
/41.9
15
/15
TRYP_PIG TRYPSIN
1s84[1] L DYB
4-(1,3,2-DIOXABOROLAN-2-YLOXY)BUTAN-1-AMINIUM[11 a..
A 85.7
/41.9
14
/14
TRYP_PIG TRYPSIN
2a31[3] I PG3
GUANIDINE-3-PROPANOL[8 atoms]
A 91.7
/41.9
12
/12
TRYP_PIG Trypsin
1v6d[1] E TBF
TERT-BUTYL FORMATE[7 atoms]
A 0.0
/41.9
1
/1
TRYP_PIG Trypsin
6i44[1] C BAM
BENZAMIDINE[9 atoms]
A 81.8
/44.2
11
/11
KLKB1_HUMAN Plasma kallikrein
5pb1[1] M BAM
BENZAMIDINE[9 atoms]
B 83.3
/40.1
12
/12
FA7_HUMAN Coagulation factor VII heavy chain
1hj8[1] C BAM
BENZAMIDINE[9 atoms]
A 50.0
/41.6
2
/2
TRY1_SALSA TRYPSIN I
2any[2] E BAM
BENZAMIDINE[9 atoms]
A 83.3
/44.0
12
/12
KLKB1_HUMAN plasma kallikrein, light chain
1hj8[1] B BAM
BENZAMIDINE[9 atoms]
A 90.9
/41.6
11
/11
TRY1_SALSA TRYPSIN I
5pab[1] C 7XD
1-[[3-[2-oxidanyl-3-(1~{H}-pyrrolo[3,2-c]pyridin-2..
A 68.8
/40.4
16
/16
FA7_HUMAN Coagulation factor VII heavy chain
5jba[3] D 0G6
D-phenylalanyl-N-[(2S,3S)-6-{[amino(iminio)methyl]..
B 76.5
/40.4
17
/17
FA9_HUMAN Coagulation factor IX
5pae[1] F 7YA
(2S)-2-hydroxy-N-[[3-[5-hydroxy-4-(1H-pyrrolo[3,2-..
B 78.6
/40.4
14
/14
FA7_HUMAN Coagulation factor VII heavy chain
5pao[1] K 7Z7
(2S)-2,3-dihydroxy-N-[[3-[5-hydroxy-4-(1H-pyrrolo[..
B 78.6
/40.4
14
/14
FA7_HUMAN Coagulation factor VII heavy chain
5pb5[1] D 9RY
N-({3-[5-hydroxy-4-(7H-pyrrolo[2,3-d]pyrimidin-6-y..
B 71.4
/40.4
14
/14
FA7_HUMAN Coagulation factor VII heavy chain
3v7t[4] I 0GX
{(3-exo)-3-[5-(aminomethyl)-2-fluorophenyl]-8-azab..
C 76.9
/40.3
13
/13
Q6NZY1_HUMAN TPSB2 protein
3v7t[4] E 0GX
{(3-exo)-3-[5-(aminomethyl)-2-fluorophenyl]-8-azab..
C 0.0
/40.3
3
/3
Q6NZY1_HUMAN TPSB2 protein
2za5[4] H 2FF
(5-(aminomethyl)-2H-spiro[benzofuran-3,4'-piperidi..
D 75.0
/40.3
16
/16
Q6B052_HUMAN Tryptase beta 2
2za5[4] H 2FF
(5-(aminomethyl)-2H-spiro[benzofuran-3,4'-piperidi..
B 0.0
/40.3
3
/3
Q6B052_HUMAN Tryptase beta 2
1a0l[4] E APA
(2S)-3-(4-carbamimidoylphenyl)-2-hydroxypropanoic ..
A 85.7
/40.3
14
/14
TRYB2_HUMAN BETA-TRYPTASE
2fs8[8] F C3A
ALLYL {(1S)-1-[(5-{4-[(2,3-DIHYDRO-1H-INDEN-2-YLAM..
B 76.2
/40.3
21
/21
TRYB2_HUMAN Tryptase beta-2
4mpw[4] F 2AJ
[(1,1,3,3-tetramethyldisiloxane-1,3-diyl)di-1-benz..
A 71.4
/40.3
14
/14
TRYB1_HUMAN Tryptase alpha/beta-1
4mpx[4] G 2AV
[(1,1,3,3-tetramethyldisiloxane-1,3-diyl)di-1-benz..
B 71.4
/40.3
14
/14
TRYB1_HUMAN Tryptase alpha/beta-1
4mpu[4] F X2A
(6S,8R)-N,N'-bis[3-({4-[3-(aminomethyl)phenyl]pipe..
A 76.9
/40.3
13
/13
TRYB1_HUMAN Tryptase alpha/beta-1
2fs9[4] F C4A
ETHYL {(1S)-5-AMINO-1-[(5-{4-[(2,3-DIHYDRO-1H-INDE..
B 70.0
/40.3
20
/20
TRYB2_HUMAN Tryptase beta-2
2zeb[4] G 11M
1-(1'-{[3-(methylsulfanyl)-2-benzothiophen-1-yl]ca..
C 75.0
/40.3
12
/12
Q6B052_HUMAN Tryptase beta 2
2zeb[4] E 11M
1-(1'-{[3-(methylsulfanyl)-2-benzothiophen-1-yl]ca..
C 0.0
/40.3
3
/3
Q6B052_HUMAN Tryptase beta 2
2zec[4] G 11N
1-[1'-(3-phenylacryloyl)spiro[1-benzofuran-3,4'-pi..
C 81.8
/40.3
11
/11
Q6B052_HUMAN Tryptase beta 2
2zec[4] E 11N
1-[1'-(3-phenylacryloyl)spiro[1-benzofuran-3,4'-pi..
C 0.0
/40.3
2
/2
Q6B052_HUMAN Tryptase beta 2
4mpv[4] C 2A4
(2R,4S)-N,N'-bis[3-({4-[3-(aminomethyl)phenyl]pipe..
A 66.7
/40.3
12
/12
TRYB1_HUMAN Tryptase alpha/beta-1
2bm2[4] H PM2
1-[3-(1-{[5-(2-PHENYLETHYL)PYRIDIN-3-YL]CARBONYL}P..
B 0.0
/40.3
3
/3
TRYB2_HUMAN HUMAN BETA2 TRYPTASE
2bm2[4] G PM2
1-[3-(1-{[5-(2-PHENYLETHYL)PYRIDIN-3-YL]CARBONYL}P..
C 76.9
/40.3
13
/13
TRYB2_HUMAN HUMAN BETA2 TRYPTASE
2fpz[4] H 270
2H-BENZOIMIDAZOL-2-YLAMINE[10 atoms]
D 90.9
/40.3
11
/11
TRYB2_HUMAN Tryptase beta-2
4a6l[4] F P43
1-{3-[1-({5-[(2-fluorophenyl)ethynyl]furan-2-yl}ca..
B 75.0
/40.3
16
/16
TRYB1_HUMAN TRYPTASE ALPHA/BETA-1
4a6l[4] E P43
1-{3-[1-({5-[(2-fluorophenyl)ethynyl]furan-2-yl}ca..
C 0.0
/40.3
2
/2
TRYB1_HUMAN TRYPTASE ALPHA/BETA-1
2gdd[4] G 5AM
BENZYL {(1S)-5-AMINO-1-[(S)-HYDROXY(5-{[4-(4-PHENY..
C 72.7
/40.3
22
/22
TRYB2_HUMAN Tryptase beta-2
4mqa[4] F X00
{(1,1,3,3-tetramethyldisiloxane-1,3-diyl)bis[5-(me..
B 71.4
/40.3
14
/14
TRYB1_HUMAN Tryptase alpha/beta-1
5f03[2] C 5TA
(5~{S})-5-[[3-(aminomethyl)phenoxy]methyl]-3-[3-[2..
A 75.0
/40.3
16
/16
TRYB2_HUMAN Tryptase beta-2
6p0p[1] C Y35
(3'-{4-[3-(aminomethyl)phenyl]piperidine-1-carbony..
A 76.9
/40.3
13
/13
TRYB1_HUMAN Tryptase alpha/beta-1
2fww[4] H C1R
4-PIPERIDINEBUTYRATE[11 atoms]
D 85.7
/40.3
14
/14
TRYB2_HUMAN Tryptase beta-2
4x8u[1] C 3ZB
5-chloro-1H-indole-2-carboxylic acid[13 atoms]
A 81.8
/40.2
11
/11
FA7_HUMAN Factor VIIa (Heavy Chain)
5u6j[1] C 82J
3-{[(2R)-17-ethyl-4-methyl-3,12-dioxo-7-[(propan-2..
A 68.2
/40.2
22
/22
FA7_HUMAN Coagulation factor VII Heavy Chain
5l30[1] C 70A
(2R,15R)-2-[(1-aminoisoquinolin-6-yl)amino]-4,15,1..
A 68.4
/40.2
19
/19
FA7_HUMAN Coagulation factor VII (Heavy Chain)
5ugd[1] B 89S
Nalpha-[trans-4-(aminomethyl)cyclohexane-1-carbony..
A 88.2
/40.1
17
/17
PLMN_HUMAN Plasminogen
5pb6[1] J 9RV
N-({3-[5-hydroxy-4-(1H-pyrrolo[3,2-c]pyridin-2-yl)..
B 78.6
/40.1
14
/14
FA7_HUMAN Coagulation factor VII heavy chain
5ugg[1] B 89M
Nalpha-[trans-4-(aminomethyl)cyclohexane-1-carbony..
A 93.8
/40.1
16
/16
PLMN_HUMAN Plasminogen
3th3[3] G 0GE
N-{[5-(dimethylamino)naphthalen-1-yl]sulfonyl}-L-a..
B 73.3
/40.1
15
/15
FA7_HUMAN Coagulation factor VII heavy chain
1z6j[1] G PY3
5-[AMINO(IMINO)METHYL]-2-[({[6-[3-AMINO-5-({[(1R)-..
B 69.6
/40.1
23
/23
FA7_HUMAN Coagulation factor VII
5wi6[5] O 0GJ
L-alpha-glutamyl-N-{(1S)-4-{[amino(iminio)methyl]a..
D 85.7
/40.3
14
/14
TRYB1_HUMAN Tryptase alpha/beta-1
5jbb[2] D 0GJ
L-alpha-glutamyl-N-{(1S)-4-{[amino(iminio)methyl]a..
B 86.7
/40.4
15
/15
FA9_HUMAN Coagulation factor IX
1bui[1] D 0GJ
L-alpha-glutamyl-N-{(1S)-4-{[amino(iminio)methyl]a..
A 100.0
/40.1
12
/12
PLMN_HUMAN Plasminogen
1wss[1] O 3CB
N-[(3-CARBOXYBENZYL)SULFONYL]ISOLEUCYL-N~1~-{4-[AM..
B 65.0
/40.1
20
/20
FA7_HUMAN Coagulation factor VII
4nga[1] C 2KF
(2R)-2-[(1-aminoisoquinolin-6-yl)amino]-2-[3-ethox..
A 68.2
/40.1
22
/22
FA7_HUMAN Factor VIIa (Heavy Chain)
4jyu[1] C 1OK
(2R)-2-[(1-aminoisoquinolin-6-yl)amino]-2-[3-ethox..
A 68.4
/40.1
19
/19
FA7_HUMAN Factor VII light chain
4jyv[1] C 1OJ
(2R)-2-[3-ethoxy-4-(propan-2-yloxy)phenyl]-2-(isoq..
A 66.7
/40.1
18
/18
FA7_HUMAN Factor VII light chain
2bz6[1] C 346
(R)-(4-CARBAMIMIDOYL-PHENYLAMINO)-[5-ETHOXY-2-FLUO..
A 76.5
/40.1
17
/17
FA7_HUMAN BLOOD COAGULATION FACTOR VIIA
5i46[1] C 67O
(2R,15R)-2-[(1-aminoisoquinolin-6-yl)amino]-8-fluo..
A 68.4
/40.1
19
/19
FA7_HUMAN Coagulation factor VII (Heavy Chain)
2zp0[1] O PI0
(2S)-N-[(4-carbamimidoylphenyl)methyl]-2-[[(2R,3R)..
B 61.9
/40.1
21
/21
FA7_HUMAN Factor VII heavy chain
2c4f[1] F GIL
2-{[6-{3-[AMINO(IMINO)METHYL]PHENOXY}-4-(DIISOPROP..
A 68.4
/40.1
19
/19
FA7_HUMAN COAGULATION FACTOR VII PRECURSOR
2fir[1] N 0G7
D-phenylalanyl-N-[(3S)-6-carbamimidamido-1-chloro-..
B 78.9
/40.1
19
/19
FA7_HUMAN Coagulation factor VII Heavy Chain (EC 3.4.21.21)
4zxx[1] C 4T0
N-{3-[(2R)-1-{(2R)-2-[(1-aminoisoquinolin-6-yl)ami..
A 63.2
/40.1
19
/19
FA7_HUMAN Coagulation factor VIIa heavy chain
2f9b[1] D N1H
{5-(5-AMINO-1H-PYRROLO[3,2-B]PYRIDIN-2-YL)-6-HYDRO..
B 68.8
/40.1
16
/16
FA7_HUMAN Coagulation factor VII
2ec9[1] P 24X
2'-((5-CARBAMIMIDOYLPYRIDIN-2-YLAMINO)METHYL)-4-(I..
B 77.8
/40.1
18
/18
FA7_HUMAN Coagulation factor VII
1wtg[1] O 3BP
2-(3-BIPHENYL-4-YL-2-ETHANESULFONYLAMINO-PROPIONYL..
B 66.7
/40.1
21
/21
FA7_HUMAN Coagulation factor VII
1fiz[3] H PBZ
P-AMINO BENZAMIDINE[10 atoms]
A 90.0
/42.9
10
/10
ACRO_PIG BETA-ACROSIN HEAVY CHAIN
1fiw[1] E PBZ
P-AMINO BENZAMIDINE[10 atoms]
A 50.0
/44.2
6
/6
ACRO_SHEEP BETA-ACROSIN HEAVY CHAIN
2a2q[1] T PBZ
P-AMINO BENZAMIDINE[10 atoms]
B 84.6
/40.1
13
/13
FA7_HUMAN Coagulation factor VII
4isi[1] C 1GG
(6S)-N-(4-carbamimidoylbenzyl)-1-chloro-3-(cyclobu..
A 68.4
/40.1
19
/19
FA7_HUMAN Factor VII heavy chain
1wun[1] O P5B
N-(ETHYLSULFONYL)TRYPTOPHYL-N~1~-{4-[AMINO(IMINO)M..
B 68.2
/40.1
22
/22
FA7_HUMAN Coagulation factor VII
4jzf[1] C 1NL
2-{2-[(3-carbamoylphenyl)carbamoyl]-6-methoxypyrid..
A 70.6
/40.1
17
/17
FA7_HUMAN Factor VIIa (Heavy Chain)
4ish[1] C 1GE
2'-[(6R,6aR,11bR)-2-carbamimidoyl-6,6a,7,11b-tetra..
A 81.2
/40.1
16
/16
FA7_HUMAN Factor VII heavy chain
4jzd[1] C 1NJ
2-{2-[(4-carbamimidoylphenyl)carbamoyl]-6-methoxyp..
A 81.2
/40.1
16
/16
FA7_HUMAN Factor VIIa (Heavy Chain)
4na9[1] C 1T7
3'-amino-5'-[(2S,4R)-6-carbamimidoyl-4-phenyl-1,2,..
A 87.5
/40.1
16
/16
FA7_HUMAN Coagulation factor VII heavy chain
5l2y[1] C 70D
1-[(2R,15R)-2-[(1-amino-4-fluoroisoquinolin-6-yl)a..
A 68.2
/40.1
22
/22
FA7_HUMAN Coagulation factor VII (Heavy Chain)
5l2z[1] C 70C
1-[(2R,15R)-2-[(1-amino-4-fluoroisoquinolin-6-yl)a..
A 66.7
/40.1
21
/21
FA7_HUMAN Coagulation factor VII (Heavy Chain)
4x8v[1] C 3Z9
methyl {3-[(2R)-1-{(2R)-2-(3,4-dimethoxyphenyl)-2-..
A 65.0
/40.1
20
/20
FA7_HUMAN Factor VIIa (Heavy Chain)
2flb[1] D 6NH
2-(4-HYDROXY-5-PHENYL-1H-PYRAZOL-3-YL)-1H-BENZOIMI..
B 80.0
/40.1
15
/15
FA7_HUMAN Coagulation factor VII
4jze[1] C 1NK
2-{2-[(1-aminoisoquinolin-6-yl)carbamoyl]-6-methox..
A 75.0
/40.1
16
/16
FA7_HUMAN Factor VIIa (Heavy Chain)
1wqv[1] O PSM
N-[DIHYDROXY(PROPYL)-LAMBDA~4~-SULFANYL]THREONYL-N..
B 68.4
/40.1
19
/19
FA7_HUMAN Coagulation factor VII
2zwl[1] N 567
2-[[(2R)-1-[[(2S)-5-amino-1-[(4-carbamimidoylpheny..
B 66.7
/40.1
21
/21
FA7_HUMAN Factor VII heavy chain
4yt6[1] C 4JY
4-[[(R)-(5-ethoxy-2-fluoranyl-3-propan-2-yloxy-phe..
A 75.0
/40.1
20
/20
FA7_HUMAN Coagulation factor VII (heavy chain)
4yt7[1] C 4K1
2-[2-[(R)-[(4-carbamimidoylphenyl)amino]-(5-ethoxy..
A 72.7
/40.1
22
/22
FA7_HUMAN Coagulation factor VII (heavy chain)
3ela[8] G 0Z6
D-phenylalanyl-N-[(2S,3S)-6-{[amino(iminio)methyl]..
B 71.4
/40.5
21
/21
FA7_HUMAN Coagulation factor VIIA heavy chain
2flr[1] D 7NH
[2'-HYDROXY-3'-(1H-PYRROLO[3,2-C]PYRIDIN-2-YL)-BIP..
B 66.7
/40.1
15
/15
FA7_HUMAN Coagulation factor VII
1ygc[2] K 905
(R)-4-[2-(3-AMINO-BENZENESULFONYLAMINO)-1-(3,5-DIE..
A 77.8
/40.1
18
/18
FA7_HUMAN Coagulation factor VII
1wv7[1] O 5PI
N-(ETHYLSULFONYL)-5-PROPOXY-L-TRYPTOPHYL-N~1~-{4-[..
B 66.7
/40.1
21
/21
FA7_HUMAN Coagulation factor VII
2aei[1] M 03R
2-({6-{3-[AMINO(IMINO)METHYL]PHENOXY}-3,5-DIFLUORO..
B 72.2
/40.1
18
/18
FA7_HUMAN Coagulation factor VII
2b7d[1] D C1B
(2R)-2-[5-(5-CARBAMIMIDOYL-1H-BENZOIMIDAZOL-2-YL)-..
B 77.8
/40.1
18
/18
FA7_HUMAN Coagulation factor VII
2zzu[1] N 359
3-[[3-[(2R)-3-[[(2S)-5-amino-1-[(4-carbamimidoylph..
B 63.6
/40.1
22
/22
FA7_HUMAN Factor VII heavy chain
5tqe[1] C 7KQ
(5R)-5-[(1-aminoisoquinolin-6-yl)amino]-19-(cyclop..
A 68.2
/40.0
22
/22
FA7_HUMAN Factor VIIa (Heavy Chain)
5paw[1] I 7XM
isoquinoline-1,6-diamine[12 atoms]
B 83.3
/39.9
12
/12
FA7_HUMAN Coagulation factor VII heavy chain
5paj[1] D 7XJ
1-(1-azanylisoquinolin-6-yl)-3-(phenylmethyl)urea[..
B 84.6
/39.9
13
/13
FA7_HUMAN Coagulation factor VII heavy chain
5pa8[1] K HAI
CYCLOHEXYLAMMONIUM ION[7 atoms]
B 80.0
/39.9
10
/10
FA7_HUMAN Coagulation factor VII heavy chain
5pat[1] C 7ZG
N-(2-amino-1H-benzimidazol-5-yl)-2-(3-chlorophenyl..
B 85.7
/39.9
14
/14
FA7_HUMAN Coagulation factor VII heavy chain
5par[1] M AX7
1H-benzimidazol-2-amine[10 atoms]
B 33.3
/39.9
6
/8
FA7_HUMAN Coagulation factor VII heavy chain
5par[1] L AX7
1H-benzimidazol-2-amine[10 atoms]
B 90.0
/39.9
10
/10
FA7_HUMAN Coagulation factor VII heavy chain
4ng9[1] C 2KE
(2R)-2-[(1-aminoisoquinolin-6-yl)amino]-2-[3-ethox..
A 65.0
/39.9
20
/20
FA7_HUMAN Factor VIIa (Heavy Chain)
5pak[1] F 7YP
(2~{S})-~{N}-[[4-(aminomethyl)-2-(2-azanyl-2-oxida..
B 75.0
/39.9
16
/16
FA7_HUMAN Coagulation factor VII heavy chain
4x8t[1] C 3Z8
7-chloro-3,4-dihydroisoquinolin-1(2H)-one[12 atoms..
A 83.3
/39.9
12
/12
FA7_HUMAN Factor VIIa (Heavy Chain)
1w8b[2] D 413
(S)-[(R)-2-(4-BENZYLOXY-3-METHOXY-PHENYL)-2-(4-CAR..
A 64.7
/40.9
17
/17
FA7_HUMAN BLOOD COAGULATION FACTOR VIIA
5pay[1] K 7ZY
1-[[3-[5-hydroxy-4-(1H-pyrrolo[3,2-c]pyridin-2-yl)..
B 73.3
/39.9
15
/15
FA7_HUMAN Coagulation factor VII heavy chain
5paa[1] J AMC
AMINOMETHYLCYCLOHEXANE[8 atoms]
B 80.0
/39.9
10
/10
FA7_HUMAN Coagulation factor VII heavy chain
5pax[1] I 7ZP
1-(2,6-difluorophenyl)-3-[[3-[5-hydroxy-4-(1H-pyrr..
B 64.7
/39.9
17
/17
FA7_HUMAN Coagulation factor VII heavy chain
5pau[1] K 7ZJ
N-(2-amino-1H-benzimidazol-5-yl)-2-[3-[(2-amino-2-..
B 76.5
/39.9
17
/17
FA7_HUMAN Coagulation factor VII heavy chain
5pas[1] E 7ZD
(2S)-2-hydroxy-N-[[3-[5-hydroxy-4-(1H-pyrrolo[3,2-..
B 73.7
/39.9
19
/19
FA7_HUMAN Coagulation factor VII heavy chain
5paq[1] J 7ZA
2-[(1-aminoisoquinolin-6-yl)amino]-2-(3-ethoxy-4-p..
B 68.4
/39.9
19
/19
FA7_HUMAN Coagulation factor VII heavy chain
5tqg[1] C 7KS
(5R,11R)-11-[(1-amino-4-fluoroisoquinolin-6-yl)ami..
A 63.6
/39.9
22
/22
FA7_HUMAN Factor VIIa (Heavy Chain)
5pam[1] J 7Z1
(2~{R})-2-[(1-azanylisoquinolin-6-yl)amino]-2-(5-e..
B 72.2
/39.9
18
/18
FA7_HUMAN Coagulation factor VII heavy chain
5paf[1] L 7LR
N-(2-amino-1H-benzimidazol-5-yl)-2-[3-[(2-amino-2-..
B 73.7
/39.9
19
/19
FA7_HUMAN Coagulation factor VII heavy chain
5pb0[1] F 7LX
(2~{R})-2-(4-ethoxy-3-methoxy-phenyl)-2-(isoquinol..
B 75.0
/39.9
16
/16
FA7_HUMAN Coagulation factor VII heavy chain
4zxy[1] C 4T1
(2R)-2-[(1-aminoisoquinolin-6-yl)amino]-4,11-diaza..
A 68.4
/39.9
19
/19
FA7_HUMAN Coagulation factor VIIa heavy chain
5pb3[1] F 9S1
N-({3-[4-(5-amino-1H-pyrrolo[3,2-b]pyridin-2-yl)-5..
B 76.5
/39.9
17
/17
FA7_HUMAN Coagulation factor VII heavy chain
5pb2[1] I 9RP
1-phenyl-4-(1H-pyrrolo[3,2-c]pyridin-2-yl)-1H-pyra..
B 83.3
/39.9
12
/12
FA7_HUMAN Coagulation factor VII heavy chain
1utj[2] B ABN
BENZYLAMINE[8 atoms]
A 90.9
/42.1
11
/11
TRY1_SALSA TRYPSIN I
5paf[1] M TFA
trifluoroacetic acid[7 atoms]
B 50.0
/39.9
4
/4
FA7_HUMAN Coagulation factor VII heavy chain
5pac[1] E 7Y7
5-hydroxy-N-(4-oxo-3H-quinazolin-6-yl)-1-[3-[(phen..
B 70.0
/39.2
20
/20
FA7_HUMAN Coagulation factor VII heavy chain
5pai[1] H 7YM
N-(2-amino-1H-benzimidazol-5-yl)-1-[3-[[(3,5-dimet..
B 70.0
/39.2
20
/20
FA7_HUMAN Coagulation factor VII heavy chain
5pag[1] E 7YJ
(2R)-2-hydroxy-N-[[3-[5-hydroxy-4-(1H-pyrrolo[3,2-..
B 84.6
/39.2
13
/13
FA7_HUMAN Coagulation factor VII heavy chain
5pan[1] J 7Z4
5-hydroxy-N-(1-oxo-1H-isoindol-6-yl)-1-(3-{[(pheny..
B 65.0
/39.2
20
/20
FA7_HUMAN Coagulation factor VII heavy chain
5pb4[1] E 9RS
N-({3-[5-hydroxy-3-methyl-4-(1H-pyrrolo[3,2-c]pyri..
B 73.3
/39.2
15
/15
FA7_HUMAN Coagulation factor VII heavy chain
4ylq[2] O 0Z7
N-acetyl-D-phenylalanyl-N-[(2S,3S)-6-carbamimidami..
B 76.2
/38.7
21
/21
FA7_HUMAN Coagulation factor VII
5tqf[1] C 7KR
(11R)-11-[(1-aminoisoquinolin-6-yl)amino]-16-(cycl..
A 68.2
/39.0
22
/22
FA7_HUMAN Factor VIIa (Heavy Chain)
1w2k[1] D 380
(2R)-2-({4-[AMINO(IMINO)METHYL]PHENYL}AMINO)-N-BEN..
A 68.8
/38.9
16
/16
FA7_HUMAN BLOOD COAGULATION FACTOR VIIA
1w0y[1] D 771
4-(4-BENZYLOXY-2-METHANESULFONYLAMINO-5-METHOXY-BE..
A 70.6
/38.9
17
/17
FA7_HUMAN BLOOD COAGULATION FACTOR VIIA
5ce1[1] B 50K
2-[6-(1-hydroxycyclohexyl)pyridin-2-yl]-1H-indole-..
A 69.2
/36.2
13
/13
HEPS_HUMAN Serine protease hepsin
3e0n[1] E PHE
PHENYLALANINE[11 atoms]
A 62.5
/36.1
8
/9
PRSS8_HUMAN Prostasin
3e0p[1] B B3C
benzyl [(1R)-1-({(2S,4R)-2-({(1S)-5-amino-1-[(S)-1..
A 63.2
/36.1
19
/20
PRSS8_HUMAN Prostasin
3e16[1] C B4C
benzyl [(1S)-5-amino-1-{[(1S)-1-({(1S)-5-amino-1-[..
A 58.8
/36.1
17
/18
PRSS8_HUMAN Prostasin
3e0n[1] D DPN
D-PHENYLALANINE[11 atoms]
A 66.7
/36.1
3
/5
PRSS8_HUMAN Prostasin
3fvf[1] C 1JZ
1-[4-(hydroxymethyl)phenyl]guanidine[12 atoms]
A 78.6
/36.1
14
/14
PRSS8_HUMAN Prostasin
3e0n[1] F ARM
DEOXY-METHYL-ARGININE[12 atoms]
A 78.6
/36.1
14
/14
PRSS8_HUMAN Prostasin
3dfl[1] B GBS
4-GUANIDINOBENZOIC ACID[12 atoms]
A 78.6
/35.6
14
/14
PRSS8_HUMAN Prostasin
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
492 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6twb[1] D NH4
AMMONIUM ION[1 atoms]
A 0.0
/44.5
1
/1
FA11_HUMAN Coagulation factor XI
6twb[1] E NH4
AMMONIUM ION[1 atoms]
A 33.3
/44.5
3
/3
FA11_HUMAN Coagulation factor XI
2aer[9] O NA
SODIUM ION[1 atoms]
B 28.6
/40.1
7
/7
FA7_HUMAN Coagulation factor VII
6ts4[1] J NA
SODIUM ION[1 atoms]
A 50.0
/43.4
4
/4
FA11_HUMAN Coagulation factor XI
1s81[2] C NA
SODIUM ION[1 atoms]
A 100.0
/41.9
6
/6
TRYP_PIG TRYPSIN
1eja[1] C NA
SODIUM ION[1 atoms]
A 0.0
/41.9
5
/5
TRYP_PIG TRYPSIN
3nps[1] K NA
SODIUM ION[1 atoms]
A 100.0
/43.6
5
/5
ST14_HUMAN Suppressor of tumorigenicity 14 protein
1xxf[1] F NA
SODIUM ION[1 atoms]
B 40.0
/44.1
5
/5
FA11_HUMAN Coagulation factor XI
6aod[1] O CO
COBALT (II) ION[1 atoms]
C 0.0
/43.4
1
/1
FA11_HUMAN Coagulation factor XI
1l4z[2] D CD
CADMIUM ION[1 atoms]
A 0.0
/39.9
3
/3
PLMN_HUMAN Plasminogen
1l4z[2] F CD
CADMIUM ION[1 atoms]
A 0.0
/39.9
1
/1
PLMN_HUMAN Plasminogen
1l4z[4] F CD
CADMIUM ION[1 atoms]
A 100.0
/39.9
2
/2
PLMN_HUMAN Plasminogen
1gl1[3] J CD
CADMIUM ION[1 atoms]
B 0.0
/41.5
2
/2
CTRA_BOVIN ALPHA-CHYMOTRYPSIN
1gl0[3] E CD
CADMIUM ION[1 atoms]
A 0.0
/41.2
1
/1
CTRA_BOVIN CHYMOTRYPSINOGEN A
2f91[1] F CD
CADMIUM ION[1 atoms]
A 0.0
/43.0
1
/1
Q52V24_PONLE hepatopancreas trypsin
2f91[1] E CD
CADMIUM ION[1 atoms]
A 0.0
/43.0
1
/1
Q52V24_PONLE hepatopancreas trypsin
1l4z[2] C CD
CADMIUM ION[1 atoms]
A 0.0
/39.9
1
/1
PLMN_HUMAN Plasminogen
1l4z[2] E CD
CADMIUM ION[1 atoms]
A 100.0
/39.9
1
/1
PLMN_HUMAN Plasminogen
1gl0[1] D CD
CADMIUM ION[1 atoms]
A 0.0
/41.2
1
/1
CTRA_BOVIN CHYMOTRYPSINOGEN A
2f91[1] G CD
CADMIUM ION[1 atoms]
A 25.0
/43.0
4
/4
Q52V24_PONLE hepatopancreas trypsin
2f91[1] C CD
CADMIUM ION[1 atoms]
A 0.0
/43.0
6
/6
Q52V24_PONLE hepatopancreas trypsin
2f91[1] H CD
CADMIUM ION[1 atoms]
A 0.0
/43.0
1
/1
Q52V24_PONLE hepatopancreas trypsin
2f91[1] D CD
CADMIUM ION[1 atoms]
A 0.0
/43.0
1
/1
Q52V24_PONLE hepatopancreas trypsin
1zr0[153] F CA
CALCIUM ION[1 atoms]
C 0.0
/41.4
4
/4
TRY1_BOVIN Cationic trypsin
1ygc[4] D CA
CALCIUM ION[1 atoms]
A 0.0
/40.1
1
/1
FA7_HUMAN Coagulation factor VII
4jzd[1] E CA
CALCIUM ION[1 atoms]
A 0.0
/40.1
4
/4
FA7_HUMAN Factor VIIa (Heavy Chain)
4bnr[7] E CA
CALCIUM ION[1 atoms]
A 0.0
/43.0
5
/5
Q52V24_PONLE HEPATOPANCREAS TRYPSIN
4bnr[2] H CA
CALCIUM ION[1 atoms]
B 25.0
/43.0
4
/4
Q52V24_PONLE HEPATOPANCREAS TRYPSIN
3gyl[1] B CA
CALCIUM ION[1 atoms]
A 33.3
/36.1
3
/3
PRSS8_HUMAN Prostasin
6n4t[1] B MG
MAGNESIUM ION[1 atoms]
A 0.0
/44.0
3
/3
ST14_HUMAN Suppressor of tumorigenicity 14 protein
2a31[2] D MG
MAGNESIUM ION[1 atoms]
A 0.0
/41.9
1
/2
TRYP_PIG Trypsin
2b8o[4] P ZN
ZINC ION[1 atoms]
B 0.0
/40.1
1
/2
FA7_HUMAN Coagulation factor VII heavy chain
2aer[4] Q ZN
ZINC ION[1 atoms]
B 0.0
/40.1
3
/3
FA7_HUMAN Coagulation factor VII
1ekb[1] E ZN
ZINC ION[1 atoms]
B 0.0
/42.5
2
/3
ENTK_BOVIN ENTEROPEPTIDASE
1ekb[1] D ZN
ZINC ION[1 atoms]
B 0.0
/42.5
1
/1
ENTK_BOVIN ENTEROPEPTIDASE
3dfj[7] B CL
CHLORIDE ION[1 atoms]
A 50.0
/35.6
2
/2
PRSS8_HUMAN Prostasin
5paa[19] I CL
CHLORIDE ION[1 atoms]
B 0.0
/39.9
1
/1
FA7_HUMAN Coagulation factor VII heavy chain
4dur[2] M CL
CHLORIDE ION[1 atoms]
B 33.3
/40.4
3
/4
PLMN_HUMAN Plasminogen
1dlk[1] G CL
CHLORIDE ION[1 atoms]
B 0.0
/41.0
1
/1
CTRA_BOVIN Thrombin heavy chain
5pao[13] L CL
CHLORIDE ION[1 atoms]
B 0.0
/40.4
3
/3
FA7_HUMAN Coagulation factor VII heavy chain
5par[15] H CL
CHLORIDE ION[1 atoms]
B 0.0
/39.9
2
/2
FA7_HUMAN Coagulation factor VII heavy chain
2b8o[6] R CL
CHLORIDE ION[1 atoms]
B 100.0
/40.1
2
/2
FA7_HUMAN Coagulation factor VII heavy chain
4mpw[4] H CL
CHLORIDE ION[1 atoms]
B 75.0
/40.3
4
/4
TRYB1_HUMAN Tryptase alpha/beta-1
4dur[1] H CL
CHLORIDE ION[1 atoms]
A 0.0
/40.9
5
/5
PLMN_HUMAN Plasminogen
2f91[2] I CL
CHLORIDE ION[1 atoms]
A 0.0
/43.0
1
/1
Q52V24_PONLE hepatopancreas trypsin
4mpx[2] E CL
CHLORIDE ION[1 atoms]
A 25.0
/40.3
4
/4
TRYB1_HUMAN Tryptase alpha/beta-1
1dlk[1] G CL
CHLORIDE ION[1 atoms]
D 0.0
/41.0
1
/1
CTRA_BOVIN Thrombin heavy chain
5pab[1] I CL
CHLORIDE ION[1 atoms]
A 100.0
/40.4
1
/1
FA7_HUMAN Coagulation factor VII heavy chain
3dfj[1] C CL
CHLORIDE ION[1 atoms]
A 20.0
/35.6
5
/5
PRSS8_HUMAN Prostasin
4crf[1] K CL
CHLORIDE ION[1 atoms]
A 40.0
/43.9
5
/5
FA11_HUMAN COAGULATION FACTOR XI
4ibl[1] V CL
CHLORIDE ION[1 atoms]
B 50.0
/40.1
4
/4
FA7_HUMAN Coagulation factor VII
4ibl[1] S RB
RUBIDIUM ION[1 atoms]
B 50.0
/40.1
4
/4
FA7_HUMAN Coagulation factor VII
4ibl[1] T RB
RUBIDIUM ION[1 atoms]
B 0.0
/40.1
2
/3
FA7_HUMAN Coagulation factor VII
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
492 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6kd5[1] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 33.3
/47.0
6
/6
TMPSD_HUMAN Transmembrane protease serine 13 (Peptidase S1 dom..
1fiw[1] C alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. A 33.3
/44.2
6
/6
ACRO_SHEEP BETA-ACROSIN HEAVY CHAIN
1fiz[2] C beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-alp.. A 33.3
/42.9
6
/6
ACRO_PIG BETA-ACROSIN HEAVY CHAIN
2f9n[2] J alpha-L-fucopyranose-(1-3)-[2-acetamido-2-deoxy-be.. D 0.0
/40.7
1
/1
TRYA1_HUMAN alpha I tryptase
2f9o[2] F alpha-L-fucopyranose-(1-3)-[2-acetamido-2-deoxy-be.. D 0.0
/40.3
1
/1
TRYA1_HUMAN Tryptase alpha-1
2f9p[1] I alpha-L-fucopyranose-(1-3)-2-acetamido-2-deoxy-bet.. G 0.0
/40.3
1
/1
Tryptase alpha-1
1qfk[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[be.. B 33.3
/40.0
3
/4
FA7_HUMAN COAGULATION FACTOR VIIA HEAVY CHAIN
2r0l[1] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 0.0
/38.2
4
/4
HGFA_HUMAN Hepatocyte growth factor activator
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
492 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6twb[1] B FA11_HUMAN Coagulation factor XI[8 aa] A 60.0
/44.5
10
/10
FA11_HUMAN Coagulation factor XI
4crg[15] A FA11_HUMAN COAGULATION FACTOR XI[234 aa] A 16.7
/44.2
6
/6
FA11_HUMAN COAGULATION FACTOR XI
4crg[15] A FA11_HUMAN COAGULATION FACTOR XI[234 aa] A 25.0
/44.2
8
/8
FA11_HUMAN COAGULATION FACTOR XI
4cr5[4] A FA11_HUMAN COAGULATION FACTOR XIA[238 aa] A 20.0
/43.7
5
/9
FA11_HUMAN COAGULATION FACTOR XIA
4is5[2] A ST14_HUMAN Suppressor of tumorigenicity 14 protein[241 aa] A 11.1
/43.6
9
/9
ST14_HUMAN Suppressor of tumorigenicity 14 protein
6a8o[2] B KLKB1_MOUSE Plasma kallikrein[236 aa] A 0.0
/43.5
5
/5
KLKB1_MOUSE Plasma kallikrein
5gvt[1] A KLKB1_MOUSE Plasma kallikrein[236 aa] B 0.0
/44.3
9
/9
KLKB1_MOUSE Plasma kallikrein
5gvt[1] B KLKB1_MOUSE Plasma kallikrein[225 aa] A 23.1
/43.5
13
/13
KLKB1_MOUSE Plasma kallikrein
1fiz[2] A ACRO_PIG BETA-ACROSIN HEAVY CHAIN[263 aa] A 0.0
/42.9
6
/8
ACRO_PIG BETA-ACROSIN HEAVY CHAIN
3myw[2] A TRYP_PIG Trypsin[223 aa] C 20.0
/41.9
5
/5
TRYP_PIG Trypsin
1p2n[18] A CTRA_BOVIN Chymotrypsinogen A[239 aa] C 50.0
/41.6
2
/2
CTRA_BOVIN Chymotrypsinogen A
2cga[1] B CTRA_BOVIN CHYMOTRYPSINOGEN A[245 aa] A 28.6
/41.5
7
/8
CTRA_BOVIN CHYMOTRYPSINOGEN A
1dlk[2] B CTRA_BOVIN Thrombin heavy chain[230 aa] D 33.3
/41.0
18
/19
CTRA_BOVIN Thrombin heavy chain
2cga[1] A CTRA_BOVIN CHYMOTRYPSINOGEN A[245 aa] B 40.0
/41.5
5
/6
CTRA_BOVIN CHYMOTRYPSINOGEN A
1rjx[27] A PLMN_HUMAN Plasminogen[243 aa] A 15.8
/40.4
19
/20
PLMN_HUMAN Plasminogen
1rjx[27] A PLMN_HUMAN Plasminogen[243 aa] A 55.6
/40.4
18
/18
PLMN_HUMAN Plasminogen
1rjx[24] A PLMN_HUMAN Plasminogen[243 aa] A 25.0
/40.4
8
/10
PLMN_HUMAN Plasminogen
1rjx[24] A PLMN_HUMAN Plasminogen[243 aa] A 28.6
/40.4
7
/7
PLMN_HUMAN Plasminogen
1rjx[6] A PLMN_HUMAN Plasminogen[243 aa] A 50.0
/40.4
2
/4
PLMN_HUMAN Plasminogen
1l4d[2] A PLMN_HUMAN PLASMINOGEN[249 aa] A 40.0
/39.9
5
/5
PLMN_HUMAN PLASMINOGEN
1bui[1] A PLMN_HUMAN Plasminogen[247 aa] B 42.9
/40.1
7
/9
PLMN_HUMAN Plasminogen
1rjx[6] A PLMN_HUMAN Plasminogen[243 aa] A 21.4
/40.4
14
/16
PLMN_HUMAN Plasminogen
1bml[2] A PLMN_HUMAN PLASMIN[250 aa] B 0.0
/39.9
4
/4
PLMN_HUMAN PLASMIN
1l4z[2] A PLMN_HUMAN Plasminogen[248 aa] A 36.8
/39.9
19
/19
PLMN_HUMAN Plasminogen
1bui[1] B PLMN_HUMAN Plasminogen[248 aa] A 50.0
/40.1
6
/6
PLMN_HUMAN Plasminogen
2gdd[76] B TRYB2_HUMAN Tryptase beta-2[243 aa] A 12.5
/40.3
8
/9
TRYB2_HUMAN Tryptase beta-2
2gdd[76] D TRYB2_HUMAN Tryptase beta-2[243 aa] A 23.8
/40.3
21
/26
TRYB2_HUMAN Tryptase beta-2
1lto[16] D TRYA_HUMAN alpha tryptase I[243 aa] C 25.0
/39.4
8
/11
TRYA_HUMAN alpha tryptase I
1lto[16] A TRYA_HUMAN alpha tryptase I[243 aa] D 7.1
/39.4
14
/19
TRYA_HUMAN alpha tryptase I
1ygc[4] A FA7_HUMAN Coagulation factor VII[254 aa] A 0.0
/40.1
2
/2
FA7_HUMAN Coagulation factor VII
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
492 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6i44[1] I PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 20.0
/44.2
5
/5
KLKB1_HUMAN Plasma kallikrein
4iso[1] F PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 50.0
/44.0
6
/7
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4iso[1] I PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 0.0
/44.0
2
/3
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4iso[1] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 40.0
/44.0
10
/10
ST14_HUMAN Suppressor of tumorigenicity 14 protein
6i58[2] H PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 50.0
/45.5
4
/6
FA11_HUMAN Coagulation factor XI
6twc[1] E ACN
ACETONE[4 atoms]
A 66.7
/44.5
3
/3
FA11_HUMAN Coagulation factor XI
6twc[1] D ACN
ACETONE[4 atoms]
A 0.0
/44.5
2
/2
FA11_HUMAN Coagulation factor XI
3ncl[1] D FMT
FORMIC ACID[3 atoms]
A 50.0
/43.6
6
/6
ST14_HUMAN Suppressor of tumorigenicity 14 protein
6i44[1] T FMT
FORMIC ACID[3 atoms]
A 80.0
/44.2
5
/5
KLKB1_HUMAN Plasma kallikrein
3ncl[1] E FMT
FORMIC ACID[3 atoms]
A 50.0
/43.6
2
/2
ST14_HUMAN Suppressor of tumorigenicity 14 protein
6i44[1] Q FMT
FORMIC ACID[3 atoms]
A 33.3
/44.2
3
/3
KLKB1_HUMAN Plasma kallikrein
5pb0[130] E GOL
GLYCEROL[6 atoms]
B 25.0
/39.9
4
/4
FA7_HUMAN Coagulation factor VII heavy chain
4isl[2] D GOL
GLYCEROL[6 atoms]
B 14.3
/43.6
7
/7
ST14_HUMAN Suppressor of tumorigenicity 14 protein
5pb1[4] L GOL
GLYCEROL[6 atoms]
B 33.3
/40.1
6
/6
FA7_HUMAN Coagulation factor VII heavy chain
3e0p[2] C GOL
GLYCEROL[6 atoms]
A 0.0
/36.1
1
/1
PRSS8_HUMAN Prostasin
4is5[2] E GOL
GLYCEROL[6 atoms]
A 33.3
/43.6
3
/5
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4is5[3] D GOL
GLYCEROL[6 atoms]
A 81.8
/43.6
11
/11
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4x6p[1] L GOL
GLYCEROL[6 atoms]
B 50.0
/43.9
6
/6
FA11_HUMAN Coagulation factor XI, light chain
6aod[2] T GOL
GLYCEROL[6 atoms]
C 0.0
/43.4
3
/3
FA11_HUMAN Coagulation factor XI
6d3y[1] D GOL
GLYCEROL[6 atoms]
A 100.0
/40.1
3
/3
PLMN_HUMAN Plasminogen
4crg[3] B GOL
GLYCEROL[6 atoms]
A 71.4
/44.2
7
/7
FA11_HUMAN COAGULATION FACTOR XI
4x6p[1] M GOL
GLYCEROL[6 atoms]
B 37.5
/43.9
8
/8
FA11_HUMAN Coagulation factor XI, light chain
4yt6[1] K GOL
GLYCEROL[6 atoms]
A 66.7
/40.1
3
/3
FA7_HUMAN Coagulation factor VII (heavy chain)
6aod[1] W GOL
GLYCEROL[6 atoms]
C 0.0
/43.4
1
/1
FA11_HUMAN Coagulation factor XI
3gyl[1] C GOL
GLYCEROL[6 atoms]
A 0.0
/36.1
5
/5
PRSS8_HUMAN Prostasin
6i44[1] CA GLY
GLYCINE[5 atoms]
A 100.0
/44.2
1
/5
KLKB1_HUMAN Plasma kallikrein
6n4t[1] C EOH
ETHANOL[3 atoms]
A 16.7
/44.0
6
/6
ST14_HUMAN Suppressor of tumorigenicity 14 protein
2any[2] D PO4
PHOSPHATE ION[5 atoms]
A 50.0
/44.0
4
/4
KLKB1_HUMAN plasma kallikrein, light chain
2any[1] C PO4
PHOSPHATE ION[5 atoms]
A 25.0
/44.0
4
/4
KLKB1_HUMAN plasma kallikrein, light chain
1yc0[1] C PO4
PHOSPHATE ION[5 atoms]
A 0.0
/38.2
1
/1
HGFA_HUMAN Hepatocyte growth factor activator
6aod[1] S PO4
PHOSPHATE ION[5 atoms]
C 50.0
/43.4
2
/2
FA11_HUMAN Coagulation factor XI
6aod[1] R PO4
PHOSPHATE ION[5 atoms]
C 50.0
/43.4
2
/2
FA11_HUMAN Coagulation factor XI
5tjx[2] D PO4
PHOSPHATE ION[5 atoms]
A 50.0
/44.7
4
/4
KLKB1_HUMAN Plasma kallikrein
5tjx[1] C PO4
PHOSPHATE ION[5 atoms]
A 60.0
/44.7
5
/5
KLKB1_HUMAN Plasma kallikrein
5jb8[5] E DMS
DIMETHYL SULFOXIDE[4 atoms]
B 20.0
/40.4
5
/5
FA9_HUMAN Coagulation factor IX
6ts4[3] H DMS
DIMETHYL SULFOXIDE[4 atoms]
A 50.0
/43.4
2
/2
FA11_HUMAN Coagulation factor XI
6ts4[2] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 0.0
/43.4
4
/4
FA11_HUMAN Coagulation factor XI
6t7p[1] J DMS
DIMETHYL SULFOXIDE[4 atoms]
A 20.0
/44.4
5
/5
KLKB1_HUMAN Plasma kallikrein
6t7p[1] H DMS
DIMETHYL SULFOXIDE[4 atoms]
A 75.0
/44.4
4
/5
KLKB1_HUMAN Plasma kallikrein
3e16[2] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 75.0
/36.1
4
/4
PRSS8_HUMAN Prostasin
6t7p[3] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 25.0
/44.4
4
/4
KLKB1_HUMAN Plasma kallikrein
6ts4[2] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 60.0
/43.4
5
/5
FA11_HUMAN Coagulation factor XI
6t7p[1] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 33.3
/44.4
6
/6
KLKB1_HUMAN Plasma kallikrein
3fvf[1] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 50.0
/36.1
6
/7
PRSS8_HUMAN Prostasin
6ts4[1] G DMS
DIMETHYL SULFOXIDE[4 atoms]
A 33.3
/43.4
3
/3
FA11_HUMAN Coagulation factor XI
6t7p[1] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 16.7
/44.4
6
/6
KLKB1_HUMAN Plasma kallikrein
6t7p[1] K DMS
DIMETHYL SULFOXIDE[4 atoms]
A 20.0
/44.4
5
/5
KLKB1_HUMAN Plasma kallikrein
3fvf[1] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 0.0
/36.1
2
/2
PRSS8_HUMAN Prostasin
6ts5[1] G DMS
DIMETHYL SULFOXIDE[4 atoms]
A 20.0
/43.9
5
/5
FA11_HUMAN Coagulation factor XI
6ts5[1] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 0.0
/43.9
3
/3
FA11_HUMAN Coagulation factor XI
6vlu[3] B CIT
CITRIC ACID[13 atoms]
A 0.0
/43.9
4
/4
FA11_HUMAN Coagulation factor XIa light chain
4x6p[1] E CIT
CITRIC ACID[13 atoms]
A 0.0
/43.9
5
/5
FA11_HUMAN Coagulation factor XI, light chain
6vlv[1] C FLC
CITRATE ANION[13 atoms]
A 55.6
/43.9
9
/9
FA11_HUMAN Coagulation factor XIa light chain
6vlv[1] B FLC
CITRATE ANION[13 atoms]
A 42.9
/43.9
7
/7
FA11_HUMAN Coagulation factor XIa light chain
4crf[1] B ALA
ALANINE[5 atoms]
A 20.0
/43.9
5
/5
FA11_HUMAN COAGULATION FACTOR XI
1zml[1] E BCT
BICARBONATE ION[4 atoms]
A 0.0
/43.7
3
/3
FA11_HUMAN Coagulation factor XI
1zsj[1] C BCT
BICARBONATE ION[4 atoms]
A 50.0
/43.7
4
/4
FA11_HUMAN Coagulation factor XI
4dur[2] J BCT
BICARBONATE ION[4 atoms]
A 75.0
/40.9
4
/4
PLMN_HUMAN Plasminogen
1zsk[2] D BCT
BICARBONATE ION[4 atoms]
A 50.0
/43.7
2
/2
FA11_HUMAN Coagulation factor XI
2fda[1] B BCT
BICARBONATE ION[4 atoms]
A 33.3
/43.7
3
/3
FA11_HUMAN Coagulation factor XI
2fda[1] D BCT
BICARBONATE ION[4 atoms]
A 33.3
/43.7
3
/3
FA11_HUMAN Coagulation factor XI
1fn6[1] F MOH
METHANOL[2 atoms]
A 100.0
/42.3
1
/1
TRYP_PIG TRYPSIN
5xwj[2] F MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 42.9
/41.9
7
/7
TRYP_PIG Trypsin
1utl[1] D MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 0.0
/42.1
6
/6
TRY1_SALSA TRYPSIN I
1s83[1] F 4HA
4-HYDROXYBUTAN-1-AMINIUM[6 atoms]
A 90.9
/41.9
11
/11
TRYP_PIG TRYPSIN
2a31[2] J BO4
BORATE ION[4 atoms]
A 0.0
/41.9
3
/3
TRYP_PIG Trypsin
5q0e[84] S EDO
1,2-ETHANEDIOL[4 atoms]
A 57.1
/44.5
7
/7
FA11_HUMAN Coagulation factor XI
4ty7[177] K EDO
1,2-ETHANEDIOL[4 atoms]
A 16.7
/44.5
6
/6
FA11_HUMAN Coagulation factor XI
3p8g[2] H EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/44.0
7
/7
Q8WVC1_HUMAN ST14 protein
5qcl[40] D EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/44.5
5
/5
FA11_HUMAN Coagulation factor XI
5q0e[21] K EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/44.5
1
/3
FA11_HUMAN Coagulation factor XI
4x6m[22] J EDO
1,2-ETHANEDIOL[4 atoms]
A 44.4
/44.5
9
/9
FA11_HUMAN Coagulation factor XI, light chain
3p8g[8] C EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/44.0
3
/4
Q8WVC1_HUMAN ST14 protein
1fn6[1] E EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/42.3
1
/1
TRYP_PIG TRYPSIN
6w50[16] M EDO
1,2-ETHANEDIOL[4 atoms]
A 20.0
/44.5
5
/5
FA11_HUMAN Coagulation factor XI
4y8x[5] M EDO
ethane-1,2-diol[4 atoms]
A 50.0
/44.5
2
/2
FA11_HUMAN Coagulation factor XIa
1s84[5] J EDO
1,2-ETHANEDIOL[4 atoms]
A 40.0
/41.9
5
/5
TRYP_PIG TRYPSIN
1s81[3] F EDO
1,2-ETHANEDIOL[4 atoms]
A 16.7
/41.9
6
/6
TRYP_PIG TRYPSIN
1fmg[2] F EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/42.3
2
/2
TRYP_PIG TRYPSIN
1s82[2] J EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/41.9
2
/2
TRYP_PIG TRYPSIN
5qtt[9] D EDO
1,2-ETHANEDIOL[4 atoms]
A 75.0
/44.5
4
/4
FA11_HUMAN Coagulation factor XI
3bn9[3] G EDO
1,2-ETHANEDIOL[4 atoms]
A 60.0
/43.6
5
/5
ST14_HUMAN Membrane-type serine protease 1
1s82[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/41.9
2
/2
TRYP_PIG TRYPSIN
2wpk[1] E EDO
1,2-ETHANEDIOL[4 atoms]
C 14.3
/39.5
7
/7
FA9_HUMAN COAGULATION FACTOR IXA HEAVY CHAIN
5q0d[3] Q EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/44.5
4
/4
FA11_HUMAN Coagulation factor XI
5qcm[1] F EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/44.5
2
/2
FA11_HUMAN Coagulation factor XI
3nps[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/43.6
1
/1
ST14_HUMAN Suppressor of tumorigenicity 14 protein
1fmg[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/42.3
4
/4
TRYP_PIG TRYPSIN
1s82[1] M SBE
1,3,2-DIOXABOROLAN-2-OL[6 atoms]
A 85.7
/41.9
7
/7
TRYP_PIG TRYPSIN
1p2q[3] O TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
C 14.3
/41.6
7
/7
CTRA_BOVIN Chymotrypsinogen A
3sos[1] C TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
A 72.7
/43.9
11
/11
FA11_HUMAN Coagulation factor XI
1zmj[1] E TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
A 0.0
/43.7
5
/5
FA11_HUMAN Coagulation factor XI
2f9p[8] L BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
E 0.0
/40.3
1
/1
Tryptase alpha-1
2f9n[8] K BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
A 16.7
/40.7
6
/6
TRYA1_HUMAN alpha I tryptase
5pb0[561] J SO4
SULFATE ION[5 atoms]
B 33.3
/39.9
3
/3
FA7_HUMAN Coagulation factor VII heavy chain
4crg[27] G SO4
SULFATE ION[5 atoms]
A 50.0
/44.2
2
/2
FA11_HUMAN COAGULATION FACTOR XI
1rjx[233] H SO4
SULFATE ION[5 atoms]
A 50.0
/40.4
2
/2
PLMN_HUMAN Plasminogen
4ty7[25] D SO4
SULFATE ION[5 atoms]
A 60.0
/44.5
10
/10
FA11_HUMAN Coagulation factor XI
5pac[59] H SO4
SULFATE ION[5 atoms]
B 33.3
/39.2
3
/3
FA7_HUMAN Coagulation factor VII heavy chain
1t7c[18] L SO4
SULFATE ION[5 atoms]
C 25.0
/41.6
4
/4
CTRA_BOVIN Chymotrypsin A
5tqg[22] F SO4
SULFATE ION[5 atoms]
A 50.0
/39.9
6
/6
FA7_HUMAN Factor VIIa (Heavy Chain)
1kli[18] F SO4
SULFATE ION[5 atoms]
B 0.0
/40.1
2
/2
FA7_HUMAN factor VIIa
5l2y[22] G SO4
SULFATE ION[5 atoms]
A 66.7
/40.1
6
/6
FA7_HUMAN Coagulation factor VII (Heavy Chain)
5lyo[20] V SO4
SULFATE ION[5 atoms]
C 50.0
/43.5
6
/6
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4crd[10] E SO4
SULFATE ION[5 atoms]
A 0.0
/43.4
1
/1
FA11_HUMAN COAGULATION FACTOR XI
4doq[1] H SO4
SULFATE ION[5 atoms]
A 0.0
/42.3
2
/2
TRYP_PIG Trypsin
4ogx[2] E SO4
SULFATE ION[5 atoms]
A 0.0
/44.2
4
/4
KLKB1_HUMAN Plasma kallikrein
4cr9[4] H SO4
SULFATE ION[5 atoms]
A 100.0
/43.7
1
/1
FA11_HUMAN COAGULATION FACTOR XI
5paj[1] J SO4
SULFATE ION[5 atoms]
B 50.0
/39.9
2
/2
FA7_HUMAN Coagulation factor VII heavy chain
1utk[1] C SO4
SULFATE ION[5 atoms]
A 14.3
/42.1
7
/7
TRY1_SALSA TRYPSIN I
1utk[1] B SO4
SULFATE ION[5 atoms]
A 100.0
/42.1
4
/4
TRY1_SALSA TRYPSIN I
5lyo[2] F SO4
SULFATE ION[5 atoms]
A 25.0
/43.5
4
/4
ST14_HUMAN Suppressor of tumorigenicity 14 protein
1fiz[2] D SO4
SULFATE ION[5 atoms]
A 0.0
/42.9
1
/1
ACRO_PIG BETA-ACROSIN HEAVY CHAIN
4mpw[8] I PGE
TRIETHYLENE GLYCOL[10 atoms]
B 50.0
/40.3
6
/6
TRYB1_HUMAN Tryptase alpha/beta-1
4isl[2] F PGE
TRIETHYLENE GLYCOL[10 atoms]
B 40.0
/43.6
5
/5
ST14_HUMAN Suppressor of tumorigenicity 14 protein
6p0p[2] I PGE
TRIETHYLENE GLYCOL[10 atoms]
B 37.5
/40.3
8
/8
TRYB1_HUMAN Tryptase alpha/beta-1
4mqa[6] D PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 50.0
/40.3
6
/6
TRYB1_HUMAN Tryptase alpha/beta-1
4isl[2] C PG4
TETRAETHYLENE GLYCOL[13 atoms]
B 0.0
/43.6
2
/2
ST14_HUMAN Suppressor of tumorigenicity 14 protein
3v7t[2] F CO3
CARBONATE ION[4 atoms]
A 80.0
/40.3
5
/5
Q6NZY1_HUMAN TPSB2 protein
6i44[1] BA ACT
ACETATE ION[4 atoms]
A 66.7
/44.2
3
/3
KLKB1_HUMAN Plasma kallikrein
4mpw[4] G ACT
ACETATE ION[4 atoms]
B 80.0
/40.3
5
/5
TRYB1_HUMAN Tryptase alpha/beta-1
1qqu[2] C ACT
ACETATE ION[4 atoms]
A 80.0
/42.3
5
/5
TRYP_PIG BETA TRYPSIN
4mpu[4] C MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 0.0
/40.3
8
/8
TRYB1_HUMAN Tryptase alpha/beta-1
4mpx[6] M MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
B 0.0
/40.3
3
/3
TRYB1_HUMAN Tryptase alpha/beta-1
6p0p[1] H MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
B 0.0
/40.3
3
/3
TRYB1_HUMAN Tryptase alpha/beta-1
5i46[1] H MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 60.0
/40.1
10
/10
FA7_HUMAN Coagulation factor VII (Heavy Chain)
1dva[6] P CAC
CACODYLATE ION[5 atoms]
D 57.1
/40.1
7
/7
FA7_HUMAN DES-GLA FACTOR VIIA (HEAVY CHAIN)
4zma[1] O CAC
CACODYLATE ION[5 atoms]
B 28.6
/39.0
7
/7
FA7_HUMAN Coagulation factor VII
4zma[1] P CAC
CACODYLATE ION[5 atoms]
B 0.0
/39.0
2
/2
FA7_HUMAN Coagulation factor VII
2wph[1] F 1PE
PENTAETHYLENE GLYCOL[16 atoms]
C 50.0
/39.5
4
/4
FA9_HUMAN COAGULATION FACTOR IXA HEAVY CHAIN
2wph[1] E 1PE
PENTAETHYLENE GLYCOL[16 atoms]
C 0.0
/39.5
2
/2
FA9_HUMAN COAGULATION FACTOR IXA HEAVY CHAIN
6r2w[2] Q TMA
TETRAMETHYLAMMONIUM ION[5 atoms]
B 0.0
/39.1
1
/3
FA7_HUMAN Coagulation factor VII
4ylq[2] BA TMA
TETRAMETHYLAMMONIUM ION[5 atoms]
B 0.0
/38.7
1
/1
FA7_HUMAN Coagulation factor VII
4ylq[1] Z TMA
TETRAMETHYLAMMONIUM ION[5 atoms]
B 50.0
/38.7
2
/2
FA7_HUMAN Coagulation factor VII
4ylq[4] X TMA
TETRAMETHYLAMMONIUM ION[5 atoms]
B 0.0
/38.7
2
/2
FA7_HUMAN Coagulation factor VII
6r2w[2] R TMA
TETRAMETHYLAMMONIUM ION[5 atoms]
B 0.0
/39.1
4
/4
FA7_HUMAN Coagulation factor VII
4ylq[1] Y TMA
TETRAMETHYLAMMONIUM ION[5 atoms]
B 50.0
/38.7
2
/2
FA7_HUMAN Coagulation factor VII
4ylq[1] V TMA
TETRAMETHYLAMMONIUM ION[5 atoms]
B 50.0
/38.7
2
/2
FA7_HUMAN Coagulation factor VII
6r2w[1] S TMA
TETRAMETHYLAMMONIUM ION[5 atoms]
B 0.0
/39.1
1
/1
FA7_HUMAN Coagulation factor VII
4ylq[1] W POL
N-PROPANOL[4 atoms]
B 0.0
/38.7
2
/2
FA7_HUMAN Coagulation factor VII
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.