[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
56847 313 237 O43765(SGTA_HUMAN) RecName: Full=Small glutamine-rich tetratricopeptide repeat-containing protein alpha;AltName: Full=Alpha-SGT;AltName: Full=Vpu-binding protein; Short=UBP;
QUERYSEQ
MDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCER
AICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLREAPSPTGGVGSFDIAGLLNNPGFMSMASNLMNNPQIQQLMSGMISGGNNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIR
SRTPSASNDDQQE
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [O43765(SGTA_HUMAN)]

313
region name description
1-313 CHAIN /note="Small glutamine-rich tetratricopeptide repeat- containing protein alpha" /id="PRO_0000106365"
91-124 REPEAT /note="TPR 1"
125-158 REPEAT /note="TPR 2"
159-192 REPEAT /note="TPR 3"
275-287 COMPBIAS /note="Gln-rich"
1-313 DISORDER predicted by DISOPRED (1-5,265-277,294-294,298-313)

MONOMER
313
pdb_id a1 identity[%]2 description
2vyi A 100.0 Q6FIA9_HUMAN SGTA PROTEIN
4cpg A 100.0 SGTA_HUMAN SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE REPEAT-CONTAINING PROTEIN ALPHA
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
313 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6q3q[2] C GLY-SER-LYS-MET-GLU-GLU-VAL-ASP[8 aa] B 0.0
/45.6
1
/1
OE64M_ARATH Outer envelope protein 64, mitochondrial
6hpg[5] H HS904_ARATH Heat shock protein 90-4[8 aa] B 53.3
/46.4
15
/15
OE64M_ARATH Outer envelope protein 64, mitochondrial
6hpg[3] I HS904_ARATH Heat shock protein 90-4[7 aa] C 60.0
/46.4
15
/15
OE64M_ARATH Outer envelope protein 64, mitochondrial
5lyn[2] C PRO-THR-VAL-GLU-GLU-VAL-ASP[7 aa] B 72.7
/45.9
11
/13
SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-cont..
3upv[1] B HSP74_YEAST Heat shock protein SSA4[7 aa] A 41.7
/33.7
12
/13
STI1_YEAST Heat shock protein STI1
4cgv[1] F HS90A_HUMAN HEAT SHOCK PROTEIN HSP 90-ALPHA[4 aa] B 80.0
/39.6
10
/10
RPAP3_HUMAN RNA POLYMERASE II-ASSOCIATED PROTEIN 3
6fdt[1] B HS71B_HUMAN Heat shock 70 kDa protein 1B[9 aa] A 63.6
/39.4
11
/12
RPAP3_HUMAN RNA polymerase II-associated protein 3
4cgw[1] D HS90A_HUMAN HEAT SHOCK PROTEIN HSP 90-ALPHA[5 aa] B 71.4
/38.9
7
/7
RPAP3_HUMAN RNA POLYMERASE II-ASSOCIATED PROTEIN 3
3kd7[5] G Hsp90 MEEVD peptide[6 aa] A 66.7
/39.0
6
/6
CTPR390
2bug[1] B Q9H2A1_HUMAN HSP90[6 aa] A 77.8
/37.5
9
/9
PPP5_HUMAN SERINE/THREONINE PROTEIN PHOSPHATASE 5
1elr[1] B HSP90-PEPTIDE MEEVD[6 aa] A 50.0
/37.1
12
/14
STIP1_HUMAN TPR2A-DOMAIN OF HOP
3fwv[2] C HS90B_HUMAN Heat shock protein HSP 90-beta[6 aa] A 57.1
/38.1
14
/16
STIP1_HUMAN Hsc70/Hsp90-organizing protein
3esk[1] B HSP7C_HUMAN Heat shock cognate 71 kDa protein[8 aa] A 54.5
/37.1
11
/13
STIP1_HUMAN Stress-induced-phosphoprotein 1
1elw[2] C HSC70-PEPTIDE[8 aa] A 52.9
/35.7
17
/17
STIP1_HUMAN TPR1-DOMAIN OF HOP
4cgu[1] B PIH1_YEAST PROTEIN INTERACTING WITH HSP90 1[81 aa] A 0.0
/35.9
1
/22
TAH1_YEAST TPR REPEAT-CONTAINING PROTEIN ASSOCIATED WITH HSP9..
4cgw[2] C HS90A_HUMAN HEAT SHOCK PROTEIN HSP 90-ALPHA[7 aa] A 58.3
/39.6
12
/12
RPAP3_HUMAN RNA POLYMERASE II-ASSOCIATED PROTEIN 3
4cgq[1] B HS90A_HUMAN HEAT SHOCK PROTEIN HSP 90-ALPHA[7 aa] A 71.4
/35.9
7
/9
TAH1_YEAST TPR REPEAT-CONTAINING PROTEIN ASSOCIATED WITH HSP9..
4cgu[1] C HS90A_HUMAN HEAT SHOCK PROTEIN HSP 90-ALPHA[7 aa] A 85.7
/35.9
7
/12
TAH1_YEAST TPR REPEAT-CONTAINING PROTEIN ASSOCIATED WITH HSP9..
2lsv[1] B HSP82_YEAST ATP-dependent molecular chaperone HSP82[9 aa] A 63.6
/35.9
11
/17
TAH1_YEAST TPR repeat-containing protein associated with Hsp9..
2l6j[1] B C-terminus Hsp90 chaperone peptide MEEVD[5 aa] A 71.4
/35.9
7
/12
TAH1_YEAST TPR repeat-containing protein associated with Hsp9..
6vfk[13] A T33_dn10B[277 aa] B 50.0
/35.0
2
/11
BG505-SOSIP-T33_dn10A
6vfh[13] B T33_dn10B[277 aa] A 50.0
/35.0
2
/9
T33_dn10A
6vfi[25] B O43_dn18A[197 aa] A 50.0
/35.0
2
/11
O43_dn18B
4kbq[1] D HSP7C_HUMAN Heat shock cognate 71 kDa protein[91 aa] A 45.0
/34.7
20
/25
CHIP_HUMAN E3 ubiquitin-protein ligase CHIP
3q49[1] B Hsp70-C peptide[7 aa] A 60.0
/34.7
10
/14
CHIP_MOUSE STIP1 homology and U box-containing protein 1
4kbq[1] C HSP7C_HUMAN Heat shock cognate 71 kDa protein[87 aa] B 60.0
/34.7
10
/12
CHIP_HUMAN E3 ubiquitin-protein ligase CHIP
3q47[1] B Smad1 peptide[7 aa] A 60.0
/34.7
10
/14
CHIP_MOUSE STIP1 homology and U box-containing protein 1
6nsv[2] D ACE-LEU-TRP-TRP-PRO-ASP[6 aa] B 54.5
/34.7
11
/13
CHIP_HUMAN E3 ubiquitin-protein ligase CHIP
3q4a[1] B Smad1 peptide[6 aa] A 54.5
/34.7
11
/14
CHIP_MOUSE STIP1 homology and U box-containing protein 1
6efk[2] D ACE-ILE-GLU-GLU-VAL-ASP[6 aa] A 54.5
/34.7
11
/14
CHIP_HUMAN E3 ubiquitin-protein ligase CHIP
6fdp[1] B HS90A_HUMAN Heat shock protein HSP 90-alpha[9 aa] A 52.9
/39.4
17
/18
RPAP3_HUMAN RNA polymerase II-associated protein 3
2c2l[4] E Q96HX7_HUMAN HSP90[9 aa] A 54.5
/34.7
11
/14
Q9DCJ0_MOUSE CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN
3fp2[1] B HSP82_YEAST ATP-dependent molecular chaperone HSP82[5 aa] A 77.8
/34.4
9
/9
YHR7_YEAST TPR repeat-containing protein YHR117W
3fp4[1] B Ssa1[7 aa] A 87.5
/34.1
8
/8
YHR7_YEAST TPR repeat-containing protein YHR117W
3lca[1] B HSP71_YEAST Heat shock protein SSA1[4 aa] A 87.5
/34.1
8
/8
TOM71_YEAST Protein TOM71
4i2z[1] B HSP90_CAEEL Heat shock protein 90[8 aa] A 46.7
/34.0
15
/15
G5EG62_CAEEL Protein UNC-45
4i2w[1] B HSP7A_CAEEL Heat shock 70 kDa protein A[10 aa] A 58.3
/34.0
12
/12
G5EG62_CAEEL Protein UNC-45
6vl6[12] V T33_dn2B[98 aa] U 38.5
/33.9
13
/13
T33_dn2A
3uq3[1] C Heat shock protein[3 aa] A 37.5
/33.3
8
/8
STI1_YEAST Heat shock protein STI1
6vfj[60] B I53_dn5A[153 aa] A 0.0
/32.8
1
/1
I53_dn5B
6vfj[61] B I53_dn5A[153 aa] A 12.5
/32.8
8
/8
I53_dn5B
6vl6[12] C T33_dn2A[122 aa] D 26.7
/32.7
15
/15
T33_dn2B
5njx[1] B Q96HX7_HUMAN HSP90AA1 protein[9 aa] A 45.5
/32.1
11
/15
FKBP5_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP5
5vie[6] D CKII[12 aa] A 0.0
/33.0
4
/4
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
4gyy[20] D CSK21_HUMAN Casein kinase II subunit alpha[14 aa] C 0.0
/33.0
5
/5
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
4gyy[18] D CSK21_HUMAN Casein kinase II subunit alpha[14 aa] C 0.0
/33.0
2
/18
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
5hgv[4] B TYR-PRO-GLY-GLY-SER-THR-PRO-VAL-SER-SER-ALA-ASN-ME.. A 20.0
/29.7
5
/5
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
5hgv[4] B TYR-PRO-GLY-GLY-SER-THR-PRO-VAL-SER-SER-ALA-ASN-ME.. A 0.0
/29.7
1
/20
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
4ay5[4] E GTAB1TIDE[11 aa] A 0.0
/29.7
1
/15
OGT1_HUMAN UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMI..
6ma3[1] B Host Cell Factor 1 peptide[13 aa] A 20.0
/29.7
20
/30
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
6tka[2] B HCF-1 pro-repeat 2 (11-26)[13 aa] A 21.1
/29.7
19
/27
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
6ma4[3] B Host Cell Factor 1 peptide[14 aa] A 20.0
/29.7
20
/30
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
4n39[2] B HCFC1_HUMAN Host cell factor 1[10 aa] A 23.5
/29.7
17
/25
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
4n3b[1] B HCFC1_HUMAN Host cell factor 1[20 aa] A 21.1
/29.7
19
/40
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
4n3a[1] B HCFC1_HUMAN Host cell factor 1[12 aa] A 20.0
/29.7
20
/28
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
4n3c[1] B HCFC1_HUMAN Host cell factor 1[20 aa] A 21.1
/29.7
19
/39
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
313 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1na3[2] G IPT
1-methylethyl 1-thio-beta-D-galactopyranoside[15 a..
B 20.0
/41.0
5
/5
designed protein CTPR2
1na0[1] N IPT
1-methylethyl 1-thio-beta-D-galactopyranoside[15 a..
B 20.0
/38.3
5
/5
designed protein CTPR3
6tka[2] D NG8
3-[2,2-bis(fluoranyl)-10,12-dimethyl-1,3-diaza-2$l..
A 25.0
/29.7
4
/4
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
5lvv[1] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/29.7
3
/6
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
313 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5lyn[2] K ZN
ZINC ION[1 atoms]
B 0.0
/45.9
2
/2
SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-cont..
5lyn[2] F ZN
ZINC ION[1 atoms]
B 0.0
/45.9
1
/1
SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-cont..
5lyn[2] J ZN
ZINC ION[1 atoms]
B 0.0
/45.9
1
/1
SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-cont..
5lyn[1] I ZN
ZINC ION[1 atoms]
B 100.0
/45.9
1
/1
SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-cont..
5lyn[1] I ZN
ZINC ION[1 atoms]
A 100.0
/45.9
1
/1
SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-cont..
6gxz[1] E CA
CALCIUM ION[1 atoms]
A 0.0
/39.4
1
/1
RPAP3_HUMAN RNA polymerase II-associated protein 3
1wao[1] L MN
MANGANESE (II) ION[1 atoms]
D 0.0
/38.8
1
/7
PPP5_HUMAN SERINE/THREONINE PROTEIN PHOSPHATASE 5
1na0[1] H PB
LEAD (II) ION[1 atoms]
B 0.0
/38.3
2
/2
designed protein CTPR3
1na0[1] G PB
LEAD (II) ION[1 atoms]
B 100.0
/38.3
1
/1
designed protein CTPR3
1na0[1] F PB
LEAD (II) ION[1 atoms]
B 0.0
/38.3
1
/1
designed protein CTPR3
1na0[1] C PB
LEAD (II) ION[1 atoms]
A 50.0
/38.3
2
/2
designed protein CTPR3
1na0[1] D PB
LEAD (II) ION[1 atoms]
A 0.0
/38.3
2
/2
designed protein CTPR3
2avp[4] C CD
CADMIUM ION[1 atoms]
A 50.0
/38.1
2
/2
synthetic consensus TPR protein
2fo7[2] C CD
CADMIUM ION[1 atoms]
A 0.0
/36.8
2
/2
SYNTHETIC CONSENSUS TPR PROTEIN
2avp[4] B CD
CADMIUM ION[1 atoms]
A 0.0
/38.1
2
/2
synthetic consensus TPR protein
2hyz[2] D SM
SAMARIUM (III) ION[1 atoms]
A 0.0
/36.8
2
/2
SYNTHETIC CONSENSUS TPR PROTEIN
2hyz[2] B SM
SAMARIUM (III) ION[1 atoms]
A 50.0
/36.8
2
/2
SYNTHETIC CONSENSUS TPR PROTEIN
1elw[2] F NI
NICKEL (II) ION[1 atoms]
A 0.0
/35.7
1
/1
STIP1_HUMAN TPR1-DOMAIN OF HOP
1elw[2] E NI
NICKEL (II) ION[1 atoms]
A 0.0
/35.7
2
/2
STIP1_HUMAN TPR1-DOMAIN OF HOP
3fwv[1] E NI
NICKEL (II) ION[1 atoms]
A 0.0
/38.1
1
/1
STIP1_HUMAN Hsc70/Hsp90-organizing protein
5jjt[2] H NI
NICKEL (II) ION[1 atoms]
B 0.0
/40.0
1
/6
PPP5_ARATH Serine/threonine-protein phosphatase 5
1elr[2] C NI
NICKEL (II) ION[1 atoms]
A 0.0
/37.1
1
/1
STIP1_HUMAN TPR2A-DOMAIN OF HOP
3esk[2] C NI
NICKEL (II) ION[1 atoms]
A 50.0
/37.1
2
/2
STIP1_HUMAN Stress-induced-phosphoprotein 1
6nsv[2] H NA
SODIUM ION[1 atoms]
B 0.0
/34.7
3
/3
CHIP_HUMAN E3 ubiquitin-protein ligase CHIP
4goe[2] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-cont..
3vty[4] I CL
CHLORIDE ION[1 atoms]
D 0.0
/28.1
4
/4
MamA
3vty[2] F CL
CHLORIDE ION[1 atoms]
C 100.0
/28.1
2
/2
MamA
3vty[1] J CL
CHLORIDE ION[1 atoms]
D 0.0
/28.1
3
/3
MamA
3fp4[1] E CL
CHLORIDE ION[1 atoms]
A 0.0
/34.1
1
/4
YHR7_YEAST TPR repeat-containing protein YHR117W
3fp4[1] C CL
CHLORIDE ION[1 atoms]
A 20.0
/34.1
5
/6
YHR7_YEAST TPR repeat-containing protein YHR117W
6nsv[1] E CL
CHLORIDE ION[1 atoms]
A 50.0
/34.7
2
/2
CHIP_HUMAN E3 ubiquitin-protein ligase CHIP
3fp4[1] J CL
CHLORIDE ION[1 atoms]
A 0.0
/34.1
2
/2
YHR7_YEAST TPR repeat-containing protein YHR117W
3fp4[1] D CL
CHLORIDE ION[1 atoms]
A 0.0
/34.1
4
/4
YHR7_YEAST TPR repeat-containing protein YHR117W
1na0[1] I CL
CHLORIDE ION[1 atoms]
B 0.0
/38.3
1
/1
designed protein CTPR3
3fp3[1] F CL
CHLORIDE ION[1 atoms]
A 16.7
/34.1
6
/6
YHR7_YEAST TPR repeat-containing protein YHR117W
4j8f[1] F IOD
IODIDE ION[1 atoms]
A 0.0
/33.3
1
/1
HSP71_HUMAN F10A1_RAT Heat shock 70 kDa protein 1A/1B, Hsc70-interacting..
4j8f[2] U IOD
IODIDE ION[1 atoms]
A 0.0
/33.3
1
/3
HSP71_HUMAN F10A1_RAT Heat shock 70 kDa protein 1A/1B, Hsc70-interacting..
4j8f[1] E IOD
IODIDE ION[1 atoms]
A 0.0
/33.3
1
/1
HSP71_HUMAN F10A1_RAT Heat shock 70 kDa protein 1A/1B, Hsc70-interacting..
4j8f[2] T IOD
IODIDE ION[1 atoms]
A 0.0
/33.3
2
/2
HSP71_HUMAN F10A1_RAT Heat shock 70 kDa protein 1A/1B, Hsc70-interacting..
1na0[1] K MG
MAGNESIUM ION[1 atoms]
B 0.0
/38.3
1
/1
designed protein CTPR3
3as5[1] C MG
MAGNESIUM ION[1 atoms]
A 0.0
/25.9
1
/1
Q50224_MAGMG MamA
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
313 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4cpg[2] A SGTA_HUMAN SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE REPEAT-CONT.. B 100.0
/100.0
23
/23
SGTA_HUMAN SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE REPEAT-CONT..
4goe[6] B SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-cont.. A 100.0
/100.0
17
/18
SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-cont..
5lyn[2] A SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-cont.. B 44.4
/45.9
9
/9
SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-cont..
6q3q[2] B OE64M_ARATH Outer envelope protein 64, mitochondrial[121 aa] A 0.0
/45.6
9
/10
OE64M_ARATH Outer envelope protein 64, mitochondrial
3sz7[2] A Q4WTC0_ASPFU Hsc70 cochaperone (SGT)[151 aa] A 46.4
/39.4
28
/46
Q4WTC0_ASPFU Hsc70 cochaperone (SGT)
3sz7[2] A Q4WTC0_ASPFU Hsc70 cochaperone (SGT)[151 aa] A 41.7
/39.4
12
/14
Q4WTC0_ASPFU Hsc70 cochaperone (SGT)
2avp[3] A synthetic consensus TPR protein[68 aa] A 33.3
/38.1
9
/11
synthetic consensus TPR protein
2avp[3] A synthetic consensus TPR protein[68 aa] A 40.0
/38.1
10
/13
synthetic consensus TPR protein
1a17[4] A PPP5_HUMAN SERINE/THREONINE PROTEIN PHOSPHATASE 5[159 aa] A 33.3
/37.5
3
/7
PPP5_HUMAN SERINE/THREONINE PROTEIN PHOSPHATASE 5
1a17[4] A PPP5_HUMAN SERINE/THREONINE PROTEIN PHOSPHATASE 5[159 aa] A 54.5
/37.5
22
/42
PPP5_HUMAN SERINE/THREONINE PROTEIN PHOSPHATASE 5
1a17[4] A PPP5_HUMAN SERINE/THREONINE PROTEIN PHOSPHATASE 5[159 aa] A 42.9
/37.5
7
/8
PPP5_HUMAN SERINE/THREONINE PROTEIN PHOSPHATASE 5
2hyz[2] A SYNTHETIC CONSENSUS TPR PROTEIN[136 aa] A 42.9
/36.8
7
/9
SYNTHETIC CONSENSUS TPR PROTEIN
2hyz[2] A SYNTHETIC CONSENSUS TPR PROTEIN[136 aa] A 0.0
/36.8
1
/11
SYNTHETIC CONSENSUS TPR PROTEIN
2wqh[2] A CTPR3Y3[104 aa] A 30.0
/36.0
10
/10
CTPR3Y3
6b85[16] D TMHC4_R[215 aa] D 0.0
/35.6
1
/31
TMHC4_R
6b85[8] C TMHC4_R[215 aa] C 0.0
/35.6
2
/33
TMHC4_R
6v8e[12] E Designed protein[118 aa] F 8.3
/35.3
12
/12
Designed protein
6vfh[36] A T33_dn10A[119 aa] A 30.0
/35.0
10
/11
T33_dn10A
6vfh[36] A T33_dn10A[119 aa] A 9.1
/35.0
11
/11
T33_dn10A
6vfk[12] B BG505-SOSIP-T33_dn10A[120 aa] B 10.0
/35.0
10
/10
BG505-SOSIP-T33_dn10A
6vfk[12] B BG505-SOSIP-T33_dn10A[120 aa] B 40.0
/35.0
5
/6
BG505-SOSIP-T33_dn10A
6vl6[12] U T33_dn2A[122 aa] M 0.0
/33.9
4
/7
T33_dn2A
6vl6[12] M T33_dn2A[122 aa] U 0.0
/33.9
7
/7
T33_dn2A
5hrz[3] A TPR domain protein 1na0C3_3[122 aa] A 0.0
/33.9
7
/8
TPR domain protein 1na0C3_3
5hrz[3] A TPR domain protein 1na0C3_3[122 aa] A 0.0
/33.9
8
/8
TPR domain protein 1na0C3_3
4j8e[2] A F10A1_RAT Hsc70-interacting protein[119 aa] B 0.0
/34.1
8
/8
F10A1_RAT Hsc70-interacting protein
4j8f[1] A HSP71_HUMAN F10A1_RAT Heat shock 70 kDa protein 1A/1B, Hsc70-interacting.. A 26.7
/33.3
15
/22
HSP71_HUMAN F10A1_RAT Heat shock 70 kDa protein 1A/1B, Hsc70-interacting..
6vfj[60] A I53_dn5B[119 aa] A 28.6
/32.8
7
/7
I53_dn5B
6vfj[60] A I53_dn5B[119 aa] A 0.0
/32.8
8
/8
I53_dn5B
6vl6[12] V T33_dn2B[98 aa] R 25.0
/32.7
8
/8
T33_dn2B
6vl6[12] T T33_dn2B[98 aa] R 0.0
/32.7
9
/9
T33_dn2B
1w3b[1] B OGT1_HUMAN UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMI.. A 10.0
/32.4
10
/10
OGT1_HUMAN UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMI..
1w3b[1] A OGT1_HUMAN UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMI.. B 11.1
/32.4
9
/9
OGT1_HUMAN UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMI..
3pe4[62] C OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami.. C 27.8
/33.0
18
/42
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
4gz6[30] C OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami.. A 11.1
/29.7
9
/10
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
2gw1[2] A TOM70_YEAST Mitochondrial precursor proteins import receptor[4.. B 0.0
/29.4
2
/34
TOM70_YEAST Mitochondrial precursor proteins import receptor
3vtx[6] B MamA[183 aa] A 10.5
/28.1
19
/34
MamA
3vty[4] A MamA[175 aa] D 40.0
/28.1
10
/21
MamA
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
313 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2wqh[2] C MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 33.3
/36.0
3
/3
CTPR3Y3
4god[1] C MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 100.0
/100.0
4
/4
SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-cont..
4god[1] D MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 100.0
/100.0
3
/3
SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-cont..
4gof[3] E BME
BETA-MERCAPTOETHANOL[4 atoms]
B 100.0
/100.0
3
/3
SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-cont..
4gof[1] E BME
BETA-MERCAPTOETHANOL[4 atoms]
A 100.0
/100.0
1
/1
SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-cont..
4gof[1] C BME
BETA-MERCAPTOETHANOL[4 atoms]
B 100.0
/100.0
1
/1
SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-cont..
5lyp[1] B BO4
BORATE ION[5 atoms]
A 33.3
/45.9
3
/3
SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-cont..
4cgv[1] G GOL
GLYCEROL[6 atoms]
D 75.0
/39.6
4
/4
RPAP3_HUMAN RNA POLYMERASE II-ASSOCIATED PROTEIN 3
4cgu[1] D GOL
GLYCEROL[6 atoms]
A 0.0
/35.9
2
/5
TAH1_YEAST TPR REPEAT-CONTAINING PROTEIN ASSOCIATED WITH HSP9..
3vtx[1] D GOL
GLYCEROL[6 atoms]
A 100.0
/28.1
1
/1
MamA
6q3q[3] G GOL
GLYCEROL[6 atoms]
A 0.0
/45.6
2
/3
OE64M_ARATH Outer envelope protein 64, mitochondrial
6q3q[2] L GOL
GLYCEROL[6 atoms]
A 0.0
/45.6
2
/2
OE64M_ARATH Outer envelope protein 64, mitochondrial
6q3q[2] L GOL
GLYCEROL[6 atoms]
B 0.0
/45.6
2
/2
OE64M_ARATH Outer envelope protein 64, mitochondrial
6q3q[2] E GOL
GLYCEROL[6 atoms]
A 0.0
/45.6
5
/5
OE64M_ARATH Outer envelope protein 64, mitochondrial
3vtx[1] C GOL
GLYCEROL[6 atoms]
A 33.3
/28.1
3
/3
MamA
5lwv[1] C GOL
GLYCEROL[6 atoms]
A 20.0
/30.0
5
/5
HCFC1_HUMAN OGT1_HUMAN Host cell factor 1,UDP-N-acetylglucosamine--peptid..
6q3q[1] N GOL
GLYCEROL[6 atoms]
B 50.0
/45.6
4
/4
OE64M_ARATH Outer envelope protein 64, mitochondrial
1na3[1] D IPT
1-methylethyl 1-thio-beta-D-galactopyranoside[5 at..
A 20.0
/41.0
5
/5
designed protein CTPR2
4gcn[1] C PGE
TRIETHYLENE GLYCOL[10 atoms]
B 80.0
/38.9
5
/5
O16259_CAEEL Protein STI-1
1na0[1] E ACT
ACETATE ION[4 atoms]
B 0.0
/38.3
5
/5
designed protein CTPR3
2wqh[2] E EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/36.0
4
/4
CTPR3Y3
2wqh[2] D EDO
1,2-ETHANEDIOL[4 atoms]
A 20.0
/36.0
5
/5
CTPR3Y3
2wqh[2] B MRD
(4R)-2-METHYLPENTANE-2,4-DIOL[8 atoms]
A 0.0
/36.0
3
/3
CTPR3Y3
1elw[4] K TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
B 40.0
/36.4
5
/5
STIP1_HUMAN TPR1-DOMAIN OF HOP
1na3[1] C TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
A 33.3
/41.0
6
/6
designed protein CTPR2
6nsv[2] I 1PE
PENTAETHYLENE GLYCOL[16 atoms]
B 20.0
/34.7
5
/5
CHIP_HUMAN E3 ubiquitin-protein ligase CHIP
5lwv[1] D PO4
PHOSPHATE ION[5 atoms]
A 0.0
/30.0
1
/3
HCFC1_HUMAN OGT1_HUMAN Host cell factor 1,UDP-N-acetylglucosamine--peptid..
4gz5[41] S SO4
SULFATE ION[5 atoms]
C 20.0
/29.7
5
/5
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
4gz6[10] O SO4
SULFATE ION[5 atoms]
A 0.0
/29.7
1
/1
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
4gz6[34] F SO4
SULFATE ION[5 atoms]
A 50.0
/29.7
4
/4
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
1a17[4] C SO4
SULFATE ION[5 atoms]
A 25.0
/37.5
4
/4
PPP5_HUMAN SERINE/THREONINE PROTEIN PHOSPHATASE 5
2c2l[4] M SO4
SULFATE ION[5 atoms]
B 20.0
/34.7
5
/5
Q9DCJ0_MOUSE CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN
1a17[4] B SO4
SULFATE ION[5 atoms]
A 66.7
/37.5
3
/4
PPP5_HUMAN SERINE/THREONINE PROTEIN PHOSPHATASE 5
5hgv[2] F SO4
SULFATE ION[5 atoms]
A 25.0
/29.7
4
/4
OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosami..
3ash[3] D SO4
SULFATE ION[5 atoms]
A 0.0
/25.9
2
/2
Q50224_MAGMG MamA
3ash[3] C SO4
SULFATE ION[5 atoms]
A 50.0
/25.9
2
/2
Q50224_MAGMG MamA
2c2l[2] L SO4
SULFATE ION[5 atoms]
B 50.0
/34.7
4
/4
Q9DCJ0_MOUSE CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN
3fp4[2] K SO4
SULFATE ION[5 atoms]
A 0.0
/34.1
1
/6
YHR7_YEAST TPR repeat-containing protein YHR117W
3as4[1] F SO4
SULFATE ION[5 atoms]
A 100.0
/25.9
1
/1
Q50224_MAGMG MamA
6q3q[2] H SO4
SULFATE ION[5 atoms]
A 25.0
/45.6
4
/4
OE64M_ARATH Outer envelope protein 64, mitochondrial
3ash[2] H SO4
SULFATE ION[5 atoms]
B 50.0
/25.9
2
/2
Q50224_MAGMG MamA
6q3q[2] I SO4
SULFATE ION[5 atoms]
A 80.0
/45.6
5
/5
OE64M_ARATH Outer envelope protein 64, mitochondrial
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.