[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
34745 7073 532 P0C6X7(R1AB_CVHSA) RecName: Full=Replicase polyprotein 1ab; Short=pp1ab;AltName: Full=ORF1ab polyprotein;Contains: RecName: Full=Host translation inhibitor nsp1; Short=nsp1; AltName: Full=Leader protein;Contains: RecName: Full=Non-structural protein 2; Short=nsp2; AltName: Full=p65 homolog;Contains: RecName: Full=Non-structural protein 3; Short=nsp3; EC=3.4.19.12; EC=3.4.22.69; AltName: Full=PL2-PRO; AltName: Full=Papain-like proteinase; Short=PL-PRO;Contains: RecName: Full=Non-structural protein 4; Short=nsp4;Contains: RecName: Full=3C-like proteinase; Short=3CL-PRO; Short=3CLp; EC=3.4.22.-; AltName: Full=SARS coronavirus main proteinase; AltName: Full=nsp5;Contains: RecName: Full=Non-structural protein 6; Short=nsp6;Contains: RecName: Full=Non-structural protein 7; Short=nsp7;Contains: RecName: Full=Non-structural protein 8; Short=nsp8;Contains: RecName: Full=Non-structural protein 9; Short=nsp9;Contains: RecName: Full=Non-structural protein 10; Short=nsp10; AltName: Full=Growth factor-like peptide; Short=GFL;Contains: RecName: Full=RNA-directed RNA polymerase; Short=Pol; Short=RdRp; EC=2.7.7.48; AltName: Full=nsp12;Contains: RecName: Full=Helicase; Short=Hel; EC=3.6.4.12; EC=3.6.4.13; AltName: Full=nsp13;Contains: RecName: Full=Proofreading exoribonuclease {ECO:0000303|PubMed:23966862, ECO:0000303|PubMed:29511076}; Short=ExoN; EC=2.1.1.-; EC=3.1.13.-; AltName: Full=Guanine-N7 methyltransferase; AltName: Full=Non-structural protein 14; Short=nsp14;Contains: RecName: Full=Uridylate-specific endoribonuclease; EC=3.1.-.-; AltName: Full=NendoU; AltName: Full=nsp15;Contains: RecName: Full=2'-O-methyltransferase; EC=2.1.1.-; AltName: Full=nsp16;
QUERYSEQ
MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELG
TDPIEDYEQNWNTKHGSGALRELTRELNGGAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRI
RSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTCGYLPTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCYNKRAYWVPRASADIGSGHTGITGDNVETLNEDL
LEILSRERVNINIVGDFHLNEEVAIILASFSASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQAAGVIRSIFARTLDAANHSIPDLQRAAVTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAY
VTGGLVQQTSQWLSNLLGTTVEKLRPIFEWIEAKLSAGVEFLKDAWEILKFLITGVFDIVKGQIQVASDNIKDCVKCFIDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQCIRGKEQLQLLMPLKAPKEVTFLEGDSHDTV
LTSEEVVLKNGELEALETPVDSFTNGAIVGTPVCVNGLMLLEIKDKEQYCALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDE
WSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGLPLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVA
GALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQK
PVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWN
LREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELG
VEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNN
CYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLC
ANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYR
HYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENTSITIKKPNELSLALGLKTIA
THGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYLNS
SNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVEC
TTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHLYFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLD
QALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSE
QLRKQIRSAAKKNNIPFRLTCATTRQVVNVITTKISLKGGKIVSTCFKLMLKATLLCVLAALVCYIVMPVHTLSIHDGYTNEIIGYKAIQDGVTRDIISTDDCFANKHAGFDAWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGTV
LRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTCERSEVGICLSTSGRWVLNNEHYRALSGVFCGVDA
MNLIANIFTPLVQPVGALDVSASVVAGGIIAILVTCAAYYFMKFRRVFGEYNHVVAANALLFLMSFTILCLVPAYSFLPGVYSVFYLYLTFYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHCHWFFNNYLRKRVMFNGVTFS
TFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR
KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYA
AVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAA
CAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITG
NTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQG
AVDINRLCEEMLDNRATLQAIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVV
VPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGP
KVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVC
GMWKGYGCSCDQLREPLMQSADASTFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNEKVAGFAKFLKTNCCRFQEKDEEGNLLDSYFVVKRHTMSNYQHEETIYNLVKDCPAVAVHDFFKFRVDGDMVPHISRQRLTKYTMADLVYAL
RHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQSLLKTVQFCDAMRDAGIVGVLTLDNQDLNGNWYDFGDFVQVAPGCGVPIVDSYYSLLMPILTLTRALAAESHMDADLAKPLIKWDLLKYDFTEERLC
LFDRYFKYWDQTYHPNCINCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKE
GSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAA
TRGATVVIGTSKFYGGWHNMLKTVYSDVETPHLMGWDYPKCDRAMPNMLRIMASLVLARKHNTCCNLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECL
YRNRDVDHEFVDEFYAYLRKHFSMMILSDDAVVCYNSNYAAQGLVASIKNFKAVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVF
HLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVG
SDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRI
TGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYI
GDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQT
TETAHSCNVNRFNVAITRAKIGILCIMSDRDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR
DAVGTNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPFMIDVQQWG
FTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIGDELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKAYKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIV
CRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTRLQSLENVAYNVVNKGHFDGHAGE
APVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGES
VKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVISKVVKVT
IDYAEISFMLWCKDGHVETFYPKLQASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWD
LIISDMYDPRTKHVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLL
EKGRLIIRENNRVVVSSDILVNN
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0C6X7(R1AB_CVHSA)]

7073
region name description
1-180 CHAIN /note="Host translation inhibitor nsp1" /id="PRO_0000037309"
181-818 CHAIN /note="Non-structural protein 2" /id="PRO_0000037310"
819-2740 CHAIN /note="Non-structural protein 3" /id="PRO_0000037311"
2741-3240 CHAIN /note="Non-structural protein 4" /id="PRO_0000283841"
3241-3546 CHAIN /note="3C-like proteinase" /id="PRO_0000037312"
3547-3836 CHAIN /note="Non-structural protein 6" /id="PRO_0000037313"
3837-3919 CHAIN /note="Non-structural protein 7" /id="PRO_0000037314"
3920-4117 CHAIN /note="Non-structural protein 8" /id="PRO_0000037315"
4118-4230 CHAIN /note="Non-structural protein 9" /id="PRO_0000037316"
4231-4369 CHAIN /note="Non-structural protein 10" /id="PRO_0000037317"
4370-5301 CHAIN /note="RNA-directed RNA polymerase" /id="PRO_0000037318"
5302-5902 CHAIN /note="Helicase" /id="PRO_0000037319"
5903-6429 CHAIN /note="Proofreading exoribonuclease" /id="PRO_0000037320"
6430-6775 CHAIN /note="Uridylate-specific endoribonuclease" /id="PRO_0000037321"
6776-7073 CHAIN /note="2'-O-methyltransferase" /id="PRO_0000037322"
1-2202 TOPO_DOM /note="Cytoplasmic"
2203-2223 TRANSMEM /note="Helical"
2224-2303 TOPO_DOM /note="Lumenal"
2304-2324 TRANSMEM /note="Helical"
2325-2350 TOPO_DOM /note="Cytoplasmic"
2351-2371 TRANSMEM /note="Helical"
2372-2754 TOPO_DOM /note="Lumenal"
2755-2775 TRANSMEM /note="Helical"
2776-2991 TOPO_DOM /note="Cytoplasmic"
2992-3012 TRANSMEM /note="Helical"
3013-3021 TOPO_DOM /note="Lumenal"
3022-3042 TRANSMEM /note="Helical"
3043-3053 TOPO_DOM /note="Cytoplasmic"
3054-3074 TRANSMEM /note="Helical"
3075-3076 TOPO_DOM /note="Lumenal"
3077-3097 TRANSMEM /note="Helical"
3098-3104 TOPO_DOM /note="Cytoplasmic"
3105-3125 TRANSMEM /note="Helical"
3126-3141 TOPO_DOM /note="Lumenal"
3142-3162 TRANSMEM /note="Helical"
3163-3563 TOPO_DOM /note="Cytoplasmic"
3564-3584 TRANSMEM /note="Helical"
3585-3585 TOPO_DOM /note="Lumenal"
3586-3606 TRANSMEM /note="Helical"
3607-3611 TOPO_DOM /note="Cytoplasmic"
3612-3632 TRANSMEM /note="Helical"
3633-3657 TOPO_DOM /note="Lumenal"
3658-3678 TRANSMEM /note="Helical"
3679-3684 TOPO_DOM /note="Cytoplasmic"
3685-3704 TRANSMEM /note="Helical"
3705-3727 TOPO_DOM /note="Lumenal"
3728-3748 TRANSMEM /note="Helical"
3749-3755 TOPO_DOM /note="Cytoplasmic"
3756-3776 TRANSMEM /note="Helical"
3777-7073 TOPO_DOM /note="Lumenal"
1003-1169 DOMAIN /note="Macro"
1611-1875 DOMAIN /note="Peptidase C16"
3241-3546 DOMAIN /note="Peptidase C30"
4981-5143 DOMAIN /note="RdRp catalytic"
5302-5385 DOMAIN /note="CV ZBD"
5558-5739 DOMAIN /note="(+)RNA virus helicase ATP-binding"
5740-5909 DOMAIN /note="(+)RNA virus helicase C-terminal"
1729-1766 ZN_FING /note="C4-type"
4304-4320 ZN_FING
4347-4360 ZN_FING
5583-5590 NP_BIND /note="ATP"
2092-2371 REGION /note="HD1"
2755-3162 REGION /note="HD2"
3564-3776 REGION /note="HD3"
930-1001 COMPBIAS /note="Glu-rich"
2210-2213 COMPBIAS /note="Poly-Leu"
3766-3769 COMPBIAS /note="Poly-Cys"
1651-1651 ACT_SITE /note="For PL-PRO activity"
1812-1812 ACT_SITE /note="For PL-PRO activity"
3281-3281 ACT_SITE /note="For 3CL-PRO activity"
3385-3385 ACT_SITE /note="For 3CL-PRO activity"
4304-4304 METAL /note="Zinc"
4307-4307 METAL /note="Zinc"
4313-4313 METAL /note="Zinc"
4320-4320 METAL /note="Zinc"
4347-4347 METAL /note="Zinc"
4350-4350 METAL /note="Zinc"
4358-4358 METAL /note="Zinc"
5306-5306 METAL /note="Zinc 1"
5309-5309 METAL /note="Zinc 1"
5317-5317 METAL /note="Zinc 2"
5320-5320 METAL /note="Zinc 1"
5327-5327 METAL /note="Zinc 1"
5330-5330 METAL /note="Zinc 2"
5334-5334 METAL /note="Zinc 2"
5340-5340 METAL /note="Zinc 2"
5351-5351 METAL /note="Zinc 3"
5356-5356 METAL /note="Zinc 3"
5373-5373 METAL /note="Zinc 3"
5376-5376 METAL /note="Zinc 3"
1-7073 DISORDER predicted by DISOPRED (1-21,23-23,215-215,217-218,380-388,730-731,754-775,876-877,883-884,886-886,916-1006,1169-1171,1174-1209,1238-1257,1320-1320,1325-1325,1327-1344,1346-1348,1351-1351,1353-1353,1380-1380,1596-1597,1706-1711,2002-2034,2125-2129,2199-2199,2201-2207,2396-2398,2521-2523,2526-2535,2538-2557,2574-2576,2585-2589,2592-2600,2605-2608,2610-2632,2882-2882,2885-2885,2926-2926,3227-3230,3233-3253,3326-3331,3334-3334,3427-3437,3489-3489,3491-3491,3520-3523,3526-3528,3534-3535,3537-3546,3548-3548,3832-3842,3915-3918,3937-4006,4009-4014,4016-4017,4023-4025,4082-4096,4113-4148,4232-4236,4238-4240,4284-4297,4362-4374,4376-4376,4422-4436,4440-4442,4446-4461,4793-4794,4797-4797,4859-4894,4917-4921,4924-4926,4943-4943,5045-5048,5050-5054,5081-5081,5084-5117,5165-5181,5262-5296,5299-5302,5435-5451,5468-5468,5530-5530,5535-5567,5622-5652,5710-5730,5768-5794,5796-5800,5892-5928,5931-5946,6036-6037,6356-6358,6363-6364,6631-6631,6633-6633,6636-6651,6687-6697,6706-6706,6910-6921,7050-7052,7055-7073)

MONOMER
7073
pdb_id a1 identity[%]2 description
7c2k A 96.3 R1AB_SARS2 RNA-directed RNA polymerase
6xez E 99.8 R1AB_SARS2 nsp13
5c8u D 100.0 R1AB_CVHSA Guanine-N7 methyltransferase
2h85 A 99.4 Q6VA80_CVHSA Putative orf1ab polyprotein
4m0w A 99.7 R1A_CVHSA Replicase polyprotein 1a
5b6o A 99.7 R1AB_CVHSA 3C-like proteinase
3r24 A 100.0 R1AB_CVHSA 2'-O-methyl transferase
2w2g B 99.6 R1A_CVHSA NON-STRUCTURAL PROTEIN 3
2ahm H 100.0 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2acf D 100.0 Replicase polyprotein 1ab
5c8u A 98.5 R1AB_CVHSA Non-structural protein 10
6nur C 100.0 R1AB_CVHSA NSP7
2gdt A 99.1 R1AB_CVHSA Leader protein; p65 homolog; NSP1 (EC 3.4.22.-)
1qz8 B 100.0 R1AB_CVHSA polyprotein 1ab
2idy A 100.0 R1AB_CVHSA NSP3
1ysy A 97.6 R1AB_CVHSA Replicase polyprotein 1ab (pp1ab) (ORF1AB)
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
7073 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3snd[2] C Peptide aldehyde inhibitor Ac-ESTLQ-H[2 aa] A 100.0
/100.0
12
/12
R1A_CVHSA 3C-like proteinase
2z3e[4] B ACE VAL Z3E LEU KCQ peptide[5 aa] A 100.0
/100.0
18
/18
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
3vb7[2] C M4Z inhibitor[4 aa] A 100.0
/100.0
20
/20
R1A_CVHSA 3C-like proteinase
3vb7[1] C M4Z inhibitor[4 aa] B 100.0
/100.0
1
/1
R1A_CVHSA 3C-like proteinase
2ahm[18] A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] H 100.0
/100.0
8
/8
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
7bzf[10] C R1AB_SARS2 Non-structural protein 7[68 aa] A 100.0
/96.3
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
2ahm[4] B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] H 100.0
/100.0
3
/3
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
6xez[1] C R1AB_SARS2 nsp7[73 aa] E 100.0
/99.8
1
/1
R1AB_SARS2 nsp13
2ahm[4] C R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] H 100.0
/100.0
10
/10
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[4] A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] E 100.0
/100.0
5
/5
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
6yyt[1] C R1AB_SARS2 nsp7[73 aa] B 100.0
/97.3
3
/3
R1AB_SARS2 nsp8
7bw4[1] C R1AB_SARS2 nsp7[65 aa] A 100.0
/96.9
10
/10
R1AB_SARS2 nsp12
6xez[1] C R1AB_SARS2 nsp7[73 aa] B 100.0
/97.3
2
/2
R1AB_SARS2 nsp8
5f22[1] A R1A_CVHSA Non-structural protein 7[79 aa] B 100.0
/100.0
25
/25
R1AB_CVHSA Non-structural protein
3sna[2] B Peptide aldehyde inhibitor Ac-NSFSQ-H[6 aa] A 100.0
/100.0
17
/17
R1A_CVHSA 3C-like proteinase
3snb[2] B Peptide aldehyde inhibitor Ac-DSFDQ-H[6 aa] A 100.0
/100.0
19
/19
R1A_CVHSA 3C-like proteinase
3sne[2] B Peptide aldehyde inhibitor Ac-ESTLQ-H[6 aa] A 100.0
/100.0
21
/21
R1A_CVHSA 3C-like proteinase
2xyv[3] A R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE [285 aa] B 95.0
/99.1
20
/20
R1AB_CVHSA NON-STRUCTURAL PROTEIN 10
3vb4[1] C B4Z inhibitor[5 aa] B 100.0
/100.0
1
/1
R1A_CVHSA 3C-like proteinase
3vb4[4] C B4Z inhibitor[5 aa] A 100.0
/100.0
21
/21
R1A_CVHSA 3C-like proteinase
3vb6[1] D C6Z inhibitor[4 aa] A 100.0
/100.0
1
/1
R1A_CVHSA 3C-like proteinase
3vb6[2] D C6Z inhibitor[4 aa] B 100.0
/100.0
16
/16
R1A_CVHSA 3C-like proteinase
3snc[2] B Peptide aldehyde inhibitor Ac-NSTSQ-H[6 aa] A 100.0
/100.0
18
/18
R1A_CVHSA 3C-like proteinase
5tl7[2] C ISG15_MOUSE Ubiquitin-like protein ISG15[77 aa] D 100.0
/100.0
24
/24
R1AB_CVHSA Replicase polyprotein 1ab
3iwm[14] G N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. C 100.0
/100.0
21
/21
R1A_CVHSA 3C-like proteinase
3iwm[6] G N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. D 100.0
/100.0
1
/1
R1A_CVHSA 3C-like proteinase
2amq[2] C N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
24
/24
R1AB_CVHSA 3C-like proteinase
1uk4[1] E 5-mer peptide of inhibitor[5 aa] B 100.0
/100.0
3
/3
R1AB_CVHSA 3C-like proteinase
1uk4[2] D 5-mer peptide of inhibitor[5 aa] B 100.0
/100.0
15
/15
R1AB_CVHSA 3C-like proteinase
2z3d[2] B Inhibitor[5 aa] A 100.0
/100.0
18
/18
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
5e6j[2] F UBB_HUMAN Polyubiquitin-B[75 aa] D 100.0
/100.0
10
/10
R1AB_CVHSA Replicase polyprotein 1ab
5e6j[5] B UBC_HUMAN ubiquitin[76 aa] A 100.0
/99.1
25
/25
R1AB_CVHSA Replicase polyprotein 1ab
3aw0[2] B peptide ACE-SER-ALA-VAL-LEU-HIS-H[6 aa] A 100.0
/99.7
18
/18
R1A_CVHSA 3C-Like Proteinase
2q6g[1] C Polypeptide chain[11 aa] A 100.0
/99.7
24
/24
R1AB_CVHSA severe acute respiratory syndrome coronavirus (SAR..
2q6g[1] D Polypeptide chain[8 aa] B 96.0
/99.7
25
/25
R1AB_CVHSA severe acute respiratory syndrome coronavirus (SAR..
3atw[2] C peptide ACE-THR-VAL-ALC-HIS-H[5 aa] A 95.2
/99.7
21
/21
R1A_CVHSA 3C-Like Proteinase
3avz[1] B peptide ACE-SER-ALA-VAL-ALC-HIS-H[6 aa] A 94.7
/99.7
19
/19
R1A_CVHSA 3C-Like Proteinase
5c8u[6] B R1AB_CVHSA Guanine-N7 methyltransferase[514 aa] A 95.7
/98.5
46
/46
R1AB_CVHSA Non-structural protein 10
6xez[1] A R1AB_SARS2 nsp12[926 aa] D 100.0
/97.3
11
/11
R1AB_SARS2 nsp8
6xez[1] A R1AB_SARS2 nsp12[926 aa] E 100.0
/99.8
3
/3
R1AB_SARS2 nsp13
6nur[1] A R1AB_CVHSA NSP12[793 aa] C 100.0
/100.0
15
/15
R1AB_CVHSA NSP7
6yyt[1] A R1AB_SARS2 nsp12[853 aa] D 100.0
/97.3
10
/10
R1AB_SARS2 nsp8
6yyt[2] A R1AB_SARS2 nsp12[853 aa] B 100.0
/97.3
44
/44
R1AB_SARS2 nsp8
6xqb[1] D R1AB_SARS2 Non-structural protein 8[31 aa] A 100.0
/97.3
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
7bv1[1] D R1AB_SARS2 nsp8[99 aa] A 100.0
/96.8
1
/1
R1AB_SARS2 nsp12
6m71[1] C R1AB_SARS2 SARS-Cov-2 NSP 8[43 aa] A 100.0
/96.7
1
/1
R1AB_SARS2 SARS-Cov-2 NSP 12
6xez[2] E R1AB_SARS2 nsp13[596 aa] D 100.0
/97.3
6
/6
R1AB_SARS2 nsp8
6xez[1] E R1AB_SARS2 nsp13[596 aa] A 100.0
/96.3
3
/3
R1AB_SARS2 nsp12
7c2k[11] B R1AB_SARS2 Non-structural protein 8[117 aa] A 100.0
/96.3
48
/48
R1AB_SARS2 RNA-directed RNA polymerase
7bw4[1] B R1AB_SARS2 nsp8[115 aa] A 100.0
/96.9
42
/42
R1AB_SARS2 nsp12
2ahm[9] F R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] B 100.0
/96.1
6
/6
R1AB_CVHSA Replicase polyprotein 1ab, light chain
2ahm[9] F R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] B 100.0
/96.1
31
/31
R1AB_CVHSA Replicase polyprotein 1ab, light chain
2ahm[4] H R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] B 100.0
/96.1
4
/4
R1AB_CVHSA Replicase polyprotein 1ab, light chain
7bzf[2] D R1AB_SARS2 Non-structural protein 8[104 aa] A 100.0
/96.3
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
2ahm[8] F R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] C 100.0
/98.6
5
/5
R1AB_CVHSA Replicase polyprotein 1ab, light chain
6nur[1] D R1A_CVHSA NSP8[109 aa] A 100.0
/100.0
2
/2
R1AB_CVHSA NSP12
6xez[1] D R1AB_SARS2 nsp8[186 aa] A 100.0
/96.3
12
/12
R1AB_SARS2 nsp12
7c2k[2] D R1AB_SARS2 Non-structural protein 8[139 aa] A 100.0
/96.3
13
/13
R1AB_SARS2 RNA-directed RNA polymerase
6xez[1] B R1AB_SARS2 nsp8[186 aa] F 100.0
/99.8
10
/10
R1AB_SARS2 nsp13
6xez[1] D R1AB_SARS2 nsp8[186 aa] E 100.0
/99.8
4
/4
R1AB_SARS2 nsp13
6xbh[2] B inhibitor UAW247[3 aa] A 100.0
/96.1
17
/17
R1AB_SARS2 main protease
6xch[6] B Leupeptin[4 aa] A 100.0
/96.1
13
/13
R1AB_SARS2 3C-like proteinase
6xfn[4] B UAW243[4 aa] A 92.9
/96.1
14
/14
R1AB_SARS2 main protease
6xbi[2] C inhibitor UAW248[5 aa] A 100.0
/96.1
20
/20
R1AB_SARS2 main protease
5nfy[4] H Q1T6X8_CVHSA Polyprotein 1ab[133 aa] C 100.0
/99.8
52
/52
Q1T6X8_CVHSA Polyprotein 1ab
6wkq[21] B R1AB_SARS2 SARS-CoV-2 NSP10[122 aa] A 100.0
/93.6
23
/23
R1AB_SARS2 SARS-CoV-2 NSP16
5c8u[6] A R1AB_CVHSA Non-structural protein 10[133 aa] B 100.0
/100.0
48
/48
R1AB_CVHSA Guanine-N7 methyltransferase
3r24[1] B R1A_CVHSA Non-structural protein 10 and Non-structural prote.. A 100.0
/100.0
21
/21
R1AB_CVHSA 2'-O-methyl transferase
6yva[1] B ISG15_MOUSE Ubiquitin-like protein ISG15[155 aa] A 79.3
/83.0
29
/29
R1A_SARS2 Replicase polyprotein 1a
6xa9[5] B ISG15_HUMAN ISG15 CTD-propargylamide[80 aa] A 90.9
/82.7
22
/22
R1AB_SARS2 Papain-like protease
6wuu[5] F VIR250[5 aa] B 100.0
/81.9
16
/16
R1AB_SARS2 papain-like protease
5yni[12] B K4LC41_9BETC nsp10 protein[120 aa] A 61.9
/65.3
21
/21
K0BWD0_9BETC nsp16 protein
4rsp[2] B Peptide inhibitor[5 aa] A 70.0
/53.4
20
/20
V9TU12_9BETC Orf1a protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
7073 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6yyt[4] F RNA product D 100.0
/97.3
3
/3
R1AB_SARS2 nsp8
6yyt[1] E RNA product A 100.0
/96.8
14
/14
R1AB_SARS2 nsp12
6yyt[1] G RNA product A 100.0
/96.8
26
/26
R1AB_SARS2 nsp12
6yyt[1] G RNA product D 100.0
/97.3
3
/3
R1AB_SARS2 nsp8
6xez[2] G Product RNA D 100.0
/97.3
3
/3
R1AB_SARS2 nsp8
6xez[1] G Product RNA A 100.0
/96.3
16
/16
R1AB_SARS2 nsp12
6xez[2] H Template RNA D 100.0
/97.3
1
/1
R1AB_SARS2 nsp8
6xez[1] H Template RNA A 100.0
/96.3
21
/21
R1AB_SARS2 nsp12
6xqb[1] F RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/97.3
19
/19
R1AB_SARS2 RNA-directed RNA polymerase
6xqb[1] E RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/97.3
15
/15
R1AB_SARS2 RNA-directed RNA polymerase
7bv2[1] D Primer A 100.0
/96.8
15
/15
R1AB_SARS2 nsp12
7bv2[1] E Templete A 100.0
/96.8
26
/26
R1AB_SARS2 nsp12
7c2k[1] F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/96.3
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
7c2k[1] E RNA (29-MER) A 100.0
/96.3
24
/24
R1AB_SARS2 RNA-directed RNA polymerase
7bzf[1] F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/96.3
13
/13
R1AB_SARS2 RNA-directed RNA polymerase
7bzf[1] E RNA (31-MER) A 100.0
/96.3
25
/25
R1AB_SARS2 RNA-directed RNA polymerase
6x1b[6] D DNA (5'-R(*GP*U)-3') B 100.0
/88.7
12
/12
R1AB_SARS2 Uridylate-specific endoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
7073 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6lny[1] B EOC
(2~{S})-4-methyl-~{N}-[(2~{S})-1-oxidanylidene-3-[..
A 100.0
/100.0
16
/16
R1A_CVHSA Replicase polyprotein 1a
2amd[2] D 9IN
N-(3-FUROYL)-D-VALYL-L-VALYL-N~1~-((1R,2Z)-4-ETHOX..
B 100.0
/100.0
22
/22
R1AB_CVHSA 3C-like proteinase
6lo0[1] B EOF
(2~{S})-4-methyl-~{N}-[(2~{S})-1-oxidanylidene-3-[..
A 100.0
/100.0
18
/18
R1A_CVHSA Replicase polyprotein 1a
2op9[2] C WR1
NALPHA-[(BENZYLOXY)CARBONYL]-N-[(1R)-4-HYDROXY-1-M..
A 100.0
/100.0
13
/13
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like ..
2vj1[1] G XP1
4-(DIMETHYLAMINO)BENZOIC ACID[8 atoms]
B 100.0
/100.0
6
/6
A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
2v6n[2] B XP1
4-(DIMETHYLAMINO)BENZOIC ACID[11 atoms]
A 100.0
/100.0
10
/10
R1AB_CVHSA REPLICASE POLYPROTEIN 1AB
5n5o[2] B 8O5
(2~{R},3~{S})-3-[[(2~{S})-3-cyclopropyl-2-[[(~{E})..
A 100.0
/100.0
17
/17
R1AB_CVHSA Replicase polyprotein 1ab
6xho[2] D V34
ethyl (2E,4S)-4-{[N-(4-methoxy-1H-indole-2-carbony..
A 100.0
/100.0
19
/19
R1A_CVHSA 3C-like proteinase
2fav[1] D APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
B 100.0
/100.0
22
/22
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab) (ORF1AB)
4ovz[2] G P85
N-[(4-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-..
B 100.0
/100.0
11
/11
R1A_CVHSA Papain-like proteinase
6wco[2] D X47
N-(4-tert-butylphenyl)-N-[(1R)-2-(cyclopentylamino..
A 100.0
/100.0
17
/17
A0A3G5BIY8_CVHSA Main protease
6y7m[2] B OEW
~{tert}-butyl ~{N}-[1-[(2~{S})-3-cyclohexyl-1-[[(2..
A 100.0
/100.0
20
/20
R1A_CVHSA Replicase polyprotein 1a
2vj1[1] D BEZ
BENZOIC ACID[9 atoms]
A 100.0
/100.0
8
/8
A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
5n19[2] B D03
(S)-N-benzyl-3-((S)-2-cinnamamido-3-phenylpropanam..
A 100.0
/100.0
21
/21
R1AB_CVHSA SARS coronavirus main protease
7jir[2] B TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be..
A 100.0
/82.4
11
/11
R1A_SARS2 Papain-like protease
2d2d[2] D ENB
ETHYL (2E,4S)-4-[((2R)-2-{[N-(TERT-BUTOXYCARBONYL)..
B 100.0
/100.0
20
/20
R1AB_CVHSA 3C-like proteinase
3szn[2] B G75
ETHYL (4R)-4-({N-[(BENZYLOXY)CARBONYL]-L-PHENYLALA..
A 100.0
/100.0
17
/17
R1A_CVHSA 3C-like proteinase
3mj5[2] C GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale..
B 100.0
/100.0
4
/4
R1A_CVHSA Replicase polyprotein 1a
3mj5[2] E GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale..
B 100.0
/100.0
11
/11
R1A_CVHSA Replicase polyprotein 1a
7c8t[4] B NOL
N-[(BENZYLOXY)CARBONYL]-O-(TERT-BUTYL)-L-THREONYL-..
A 100.0
/96.1
23
/23
R1AB_SARS2 3C-like proteinase
2gx4[2] B NOL
N-[(BENZYLOXY)CARBONYL]-O-(TERT-BUTYL)-L-THREONYL-..
A 100.0
/100.0
1
/1
R1AB_CVHSA 3C-like proteinase
6xhn[2] E V3D
(3S)-3-{[N-(4-methoxy-1H-indole-2-carbonyl)-L-leuc..
B 100.0
/100.0
18
/18
R1A_CVHSA 3C-like proteinase
1wof[2] C I12
N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]-L-ALANYL-L-VAL..
A 100.0
/100.0
23
/23
R1AB_CVHSA 3C-like proteinase
2z94[2] C TLD
4-methylbenzene-1,2-dithiol[9 atoms]
A 100.0
/100.0
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
2zu4[2] B ZU3
N-[(benzyloxy)carbonyl]-3-[(2,2-dimethylpropanoyl)..
A 100.0
/100.0
22
/22
R1A_CVHSA 3C-like proteinase
2zu4[2] B ZU3
N-[(benzyloxy)carbonyl]-3-[(2,2-dimethylpropanoyl)..
A 100.0
/100.0
1
/1
R1A_CVHSA 3C-like proteinase
2zu5[2] B ZU5
N-[(benzyloxy)carbonyl]-O-tert-butyl-L-threonyl-N-..
A 100.0
/100.0
1
/1
R1A_CVHSA 3C-like proteinase
2zu5[2] B ZU5
N-[(benzyloxy)carbonyl]-O-tert-butyl-L-threonyl-N-..
A 100.0
/100.0
22
/22
R1A_CVHSA 3C-like proteinase
4ow0[2] D S88
N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-..
A 100.0
/100.0
10
/10
R1A_CVHSA papain-like protease
3sn8[2] B S89
N-[(2S)-1-hydroxy-3-phenylpropan-2-yl]-Nalpha-[(2E..
A 100.0
/100.0
15
/15
R1A_CVHSA 3C-like proteinase
2a5k[6] C AZP
(5S,8S,14R)-ETHYL 11-(3-AMINO-3-OXOPROPYL)-8-BENZY..
A 100.0
/100.0
24
/24
R1AB_CVHSA 3C-like peptidase
3d62[2] B 959
benzyl (2-oxopropyl)carbamate[15 atoms]
A 100.0
/100.0
10
/10
R1AB_CVHSA 3C-like proteinase
2gz8[2] B F3F
S-[5-(TRIFLUOROMETHYL)-4H-1,2,4-TRIAZOL-3-YL] 5-(P..
A 100.0
/100.0
14
/14
R1AB_CVHSA Replicase polyprotein 1ab
5c8s[2] T G3A
GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms..
D 100.0
/100.0
16
/16
R1AB_CVHSA Guanine-N7 methyltransferase
2alv[2] B CY6
N-((3S,6R)-6-((S,E)-4-ETHOXYCARBONYL-1-((S)-2-OXOP..
A 100.0
/100.0
24
/24
R1AB_CVHSA Replicase polyprotein 1ab
6lnq[1] B EJF
N-[(2S)-3-methyl-1-[[(2S)-4-methyl-1-oxidanylidene..
A 100.0
/100.0
19
/19
Severe Acute Respiratory Syndrome Coronavirus 3c L..
4mds[2] B 23H
N-[4-(acetylamino)phenyl]-2-(1H-benzotriazol-1-yl)..
A 100.0
/100.0
18
/18
R1A_CVHSA 3C-like proteinase
3tnt[2] B G85
N-[(benzyloxy)carbonyl]-O-tert-butyl-L-seryl-N-{(2..
A 100.0
/100.0
22
/22
R1A_CVHSA SARS coronavirus main protease
3v3m[2] B 0EN
N-[(1R)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)..
A 100.0
/100.0
15
/15
R1A_CVHSA 3C-like proteinase
3tit[2] B G81
ETHYL (4R)-4-{[N-(TERT-BUTOXYCARBONYL)-L-PHENYLALA..
A 100.0
/100.0
15
/15
R1A_CVHSA SARS coronavirus main protease
3tiu[2] C G82
ETHYL (5S,8S,11R)-8-BENZYL-5-(3-TERT-BUTOXY-3-OXOP..
A 100.0
/100.0
23
/23
R1A_CVHSA SARS coronavirus main protease
3tns[2] B G83
ETHYL (5S,8S,11R)-8-BENZYL-5-(2-TERT-BUTOXY-2-OXOE..
A 100.0
/100.0
1
/1
R1A_CVHSA SARS coronavirus main protease
3tns[2] B G83
ETHYL (5S,8S,11R)-8-BENZYL-5-(2-TERT-BUTOXY-2-OXOE..
A 100.0
/100.0
24
/24
R1A_CVHSA SARS coronavirus main protease
2gz7[2] B D3F
2-[(2,4-DICHLORO-5-METHYLPHENYL)SULFONYL]-1,3-DINI..
A 100.0
/100.0
13
/13
R1AB_CVHSA Replicase polyprotein 1ab
6xez[2] Y ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
F 100.0
/99.8
9
/9
R1AB_SARS2 nsp13
6xez[1] L ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 100.0
/96.3
11
/11
R1AB_SARS2 nsp12
6xez[1] U 1N7
CHAPSO[36 atoms]
A 100.0
/96.3
1
/1
R1AB_SARS2 nsp12
6xez[1] N 1N7
CHAPSO[26 atoms]
A 100.0
/96.3
4
/4
R1AB_SARS2 nsp12
6xez[1] M 1N7
CHAPSO[35 atoms]
A 33.3
/96.3
3
/3
R1AB_SARS2 nsp12
6xez[1] U 1N7
CHAPSO[36 atoms]
E 100.0
/99.8
3
/3
R1AB_SARS2 nsp13
4m0w[1] E NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 100.0
/99.7
7
/7
R1A_CVHSA Replicase polyprotein 1a
4m0w[1] F NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 100.0
/99.7
6
/6
R1A_CVHSA Replicase polyprotein 1a
4wy3[1] B 3X5
(2S)-2-({[(3R,4aS,8aR)-2-(biphenyl-4-ylcarbonyl)de..
A 93.8
/99.7
16
/16
R1AB_CVHSA 3C-like proteinase
4twy[2] B 3BL
(2S)-2-({[(3S,4aR,8aS)-2-(biphenyl-4-ylcarbonyl)de..
A 94.4
/99.7
18
/18
R1AB_CVHSA 3C-like proteinase
5c5n[2] B SLH
(2S)-3-(1H-imidazol-5-yl)-2-({[(3R,4aS,8aR)-2-(N-p..
A 93.3
/99.7
15
/15
R1AB_CVHSA 3C-like proteinase
4tww[2] C 3A7
(2S)-2-({[(3S,4aR,8aS)-2-(4-bromobenzoyl)decahydro..
A 93.3
/99.7
15
/15
R1AB_CVHSA 3C-like proteinase
6vh3[5] D QYS
(1S,2S)-2-[(N-{[(4,4-difluorocyclohexyl)methoxy]ca..
B 63.2
/53.7
19
/19
A0A1L2E0X0_9BETC Orf1a protein
6w2a[1] C VDJ
[4,4-bis(fluoranyl)cyclohexyl]methyl ~{N}-[(2~{S})..
A 100.0
/99.7
16
/16
R1A_CVHSA Replicase polyprotein 1a
2qiq[2] B CYV
ETHYL (4R)-4-{[(2R,5S)-5-{[N-(TERT-BUTOXYCARBONYL)..
A 100.0
/99.7
23
/23
R1AB_CVHSA Replicase polyprotein 1ab
5c5o[2] D SDJ
(2S)-3-(1H-imidazol-5-yl)-2-({[(3S,4aR,8aS)-2-(N-p..
B 94.4
/99.7
18
/18
R1AB_CVHSA 3C-like proteinase
7bv2[1] K F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-..
A 100.0
/96.8
7
/7
R1AB_SARS2 nsp12
7c7p[1] E FK3
(3~{S},3~{a}~{S},6~{a}~{R})-~{N}-[(2~{R},3~{S})-1-..
B 100.0
/96.3
13
/13
R1AB_SARS2 main protease
6xqt[2] D NNA
(1R,2S,5S)-3-[N-({1-[(tert-butylsulfonyl)methyl]cy..
B 100.0
/96.1
23
/23
R1AB_SARS2 3C-like proteinase
6zru[6] D U5G
boceprevir (bound form)[37 atoms]
A 100.0
/96.1
17
/17
R1AB_SARS2 Main Protease
6yvf[2] B A82
2-[[(1R)-1-(7-methyl-2-morpholin-4-yl-4-oxidanylid..
A 85.7
/96.1
7
/7
R1AB_SARS2 Replicase polyprotein 1ab
7c8r[2] B TG3
ethyl (4R)-4-[[(2S)-4-methyl-2-[[(2S,3R)-3-[(2-met..
A 100.0
/96.1
1
/1
R1AB_SARS2 3C-like proteinase
7c8r[2] B TG3
ethyl (4R)-4-[[(2S)-4-methyl-2-[[(2S,3R)-3-[(2-met..
A 100.0
/96.1
23
/23
R1AB_SARS2 3C-like proteinase
6z2e[2] B Q5T
(4~{S})-4-[[(2~{S})-2-[[(2~{S})-2-[[(2~{S})-2-[3-[..
A 100.0
/96.1
21
/21
R1AB_SARS2 Main Protease
6xb2[2] C NEN
1-ETHYL-PYRROLIDINE-2,5-DIONE[9 atoms]
A 100.0
/96.1
4
/4
R1AB_SARS2 3C-like proteinase
6xb1[4] B NEN
1-ETHYL-PYRROLIDINE-2,5-DIONE[9 atoms]
A 100.0
/96.1
4
/4
R1AB_SARS2 3C-like proteinase
6wtk[1] B UED
N~2~-[(benzyloxy)carbonyl]-N-{(2S)-1-hydroxy-3-[(3..
A 100.0
/96.1
17
/17
R1AB_SARS2 3C-like proteinase
6m2n[4] F 3WL
5,6,7-trihydroxy-2-phenyl-4H-chromen-4-one[20 atom..
B 100.0
/96.1
15
/15
SARS-CoV-2 3CL protease
7buy[2] B JRY
hexylcarbamic acid[9 atoms]
A 100.0
/96.1
8
/8
SARS-CoV-2 virus Main protease
6yt8[2] B PK8
9-oxa-7-thia-1-azonia-8$l^{2}-zincabicyclo[4.3.0]n..
A 100.0
/96.1
6
/6
R1AB_SARS2 Replicase polyprotein 1ab
6ynq[2] B P6N
(2~{S})-2-methyl-3,4-dihydro-2~{H}-naphthalen-1-on..
A 100.0
/96.1
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6ynq[2] B P6N
(2~{S})-2-methyl-3,4-dihydro-2~{H}-naphthalen-1-on..
A 100.0
/96.1
8
/8
R1AB_SARS2 Replicase polyprotein 1ab
6w63[2] B X77
N-(4-tert-butylphenyl)-N-[(1R)-2-(cyclohexylamino)..
A 100.0
/96.1
16
/16
R1AB_SARS2 3C-like proteinase
5rha[4] B T8M
1-{4-[(thiophen-2-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/96.1
11
/11
R1AB_SARS2 3C-like proteinase
5r7y[2] B JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
A 88.9
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5rfu[2] F T8D
1-{4-[(5-chlorothiophen-2-yl)sulfonyl]piperazin-1-..
A 100.0
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
5rft[2] E T8A
1-[(4S)-4-phenyl-3,4-dihydroisoquinolin-2(1H)-yl]e..
A 100.0
/96.1
11
/11
R1AB_SARS2 3C-like proteinase
5rfi[2] E T71
1-{4-[(2,5-dimethylphenyl)sulfonyl]piperazin-1-yl}..
A 90.0
/96.1
10
/10
R1AB_SARS2 3C-like proteinase
5rg0[2] F T8Y
1,1'-(piperazine-1,4-diyl)di(ethan-1-one)[12 atoms..
A 100.0
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5rfz[2] E T8V
N-(2-chloropyridin-3-yl)acetamide[11 atoms]
A 100.0
/96.1
8
/8
R1AB_SARS2 3C-like proteinase
5rgu[2] B UGD
N-(3-{[(2R)-4-oxoazetidin-2-yl]oxy}phenyl)-2-(pyri..
A 100.0
/96.1
16
/16
R1AB_SARS2 3C-like proteinase
5rfy[2] E T8S
1-acetyl-N-methyl-N-(propan-2-yl)piperidine-4-carb..
A 90.0
/96.1
10
/10
R1AB_SARS2 3C-like proteinase
5rfx[2] E T8P
1-[4-(4-methoxyphenyl)piperazin-1-yl]ethan-1-one[1..
A 100.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
5rh9[2] F UJ4
N-{4-[(1S)-1-methoxyethyl]phenyl}-N-[(1R)-2-[(4-me..
A 100.0
/96.1
19
/19
R1AB_SARS2 3C-like proteinase
5re5[2] E T0J
N~1~-phenylpiperidine-1,4-dicarboxamide[18 atoms]
A 100.0
/96.1
4
/4
R1AB_SARS2 3C-like proteinase
5reh[2] E AWP
1-cyclohexyl-3-(2-pyridin-4-ylethyl)urea[18 atoms]..
A 100.0
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
5re8[2] E T0V
1-(3-fluorophenyl)-N-[(furan-2-yl)methyl]methanami..
A 83.3
/96.1
6
/6
R1AB_SARS2 3C-like proteinase
5re7[2] E T0S
N-[(4-sulfamoylphenyl)methyl]acetamide[15 atoms]
A 100.0
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
6xqs[5] B SV6
(1S,3aR,6aS)-2-[(2S)-2-({(2S)-2-cyclohexyl-2-[(pyr..
A 100.0
/96.1
19
/19
R1AB_SARS2 3C-like proteinase
5reb[2] E T0Y
1-[(thiophen-3-yl)methyl]piperidin-4-ol[13 atoms]
A 88.9
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5re9[2] E LPZ
2-(4-methylphenoxy)-1-(4-methylpiperazin-4-ium-1-y..
A 100.0
/96.1
6
/6
R1AB_SARS2 3C-like proteinase
5red[2] E JJG
4-[2-(phenylsulfanyl)ethyl]morpholine[15 atoms]
A 100.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
5rfj[2] E T7A
N-(4-methoxy-1,3-benzothiazol-2-yl)acetamide[15 at..
A 91.7
/96.1
12
/12
R1AB_SARS2 3C-like proteinase
5rfl[2] E T7G
1-acetyl-N-(2-hydroxyphenyl)piperidine-4-carboxami..
A 83.3
/96.1
6
/6
R1AB_SARS2 3C-like proteinase
5rfk[2] E T7D
N-(1-acetylpiperidin-4-yl)benzamide[18 atoms]
A 83.3
/96.1
6
/6
R1AB_SARS2 3C-like proteinase
5rf8[2] E SFY
4-amino-N-(pyridin-2-yl)benzenesulfonamide[17 atom..
A 100.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
5rfm[2] E T7J
N-[(3R)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/96.1
10
/10
R1AB_SARS2 3C-like proteinase
5rfn[2] E T7P
N-[(3R)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/96.1
10
/10
R1AB_SARS2 3C-like proteinase
5rfp[2] E T7V
N-[(1S)-1-(3-chlorophenyl)ethyl]acetamide[13 atoms..
A 100.0
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
5rfs[2] F T84
1-{4-[(thiophen-3-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/96.1
12
/12
R1AB_SARS2 3C-like proteinase
5rfr[2] E T81
1-{4-[(5-bromothiophen-2-yl)methyl]piperazin-1-yl}..
A 92.3
/96.1
13
/13
R1AB_SARS2 3C-like proteinase
5r84[2] B GWS
2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide[16 atoms..
A 100.0
/96.1
13
/13
R1AB_SARS2 3C-like proteinase
5rh2[2] B UH7
2-(3-chlorophenyl)-N-(4-methylpyridin-3-yl)acetami..
A 100.0
/96.1
14
/14
R1AB_SARS2 3C-like proteinase
5rh0[2] B UH4
N-(5-methylthiophen-2-yl)-N'-pyridin-3-ylurea[16 a..
A 100.0
/96.1
11
/11
R1AB_SARS2 3C-like proteinase
5rgz[2] B UH1
2-(3-cyanophenyl)-N-(pyridin-3-yl)acetamide[18 ato..
A 100.0
/96.1
14
/14
R1AB_SARS2 3C-like proteinase
5rem[2] E T2J
1 1-(4-(2-nitrophenyl)piperazin-1-yl)ethan-1-one[1..
A 90.9
/96.1
11
/11
R1AB_SARS2 3C-like proteinase
5rgw[2] B UGM
2-(5-cyanopyridin-3-yl)-N-(pyridin-3-yl)acetamide[..
A 100.0
/96.1
14
/14
R1AB_SARS2 3C-like proteinase
5rfo[2] E T7S
1-[4-(piperidine-1-carbonyl)piperidin-1-yl]ethan-1..
A 100.0
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
5rgv[2] B UGG
2-(isoquinolin-4-yl)-N-phenylacetamide[20 atoms]
A 100.0
/96.1
12
/12
R1AB_SARS2 3C-like proteinase
5rgv[2] B UGG
2-(isoquinolin-4-yl)-N-phenylacetamide[20 atoms]
A 100.0
/96.1
1
/1
R1AB_SARS2 3C-like proteinase
5rel[2] E T2G
1-{4-[(3-methylphenyl)methyl]piperazin-1-yl}ethan-..
A 100.0
/96.1
10
/10
R1AB_SARS2 3C-like proteinase
5reo[2] E T2Y
N-[(2H-1,3-benzodioxol-5-yl)methyl]acetamide[14 at..
A 100.0
/96.1
6
/6
R1AB_SARS2 3C-like proteinase
5re4[2] E SZY
N-(4-methylpyridin-3-yl)acetamide[11 atoms]
A 100.0
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5rgy[2] B UGS
N-(4-methoxypyridin-2-yl)-2-(naphthalen-2-yl)aceta..
A 100.0
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5rgx[2] B UGP
2-(3-cyanophenyl)-N-(4-methylpyridin-3-yl)acetamid..
A 100.0
/96.1
14
/14
R1AB_SARS2 3C-like proteinase
5rh1[2] B UGV
2-(5-chlorothiophen-2-yl)-N-(pyridin-3-yl)acetamid..
A 100.0
/96.1
12
/12
R1AB_SARS2 3C-like proteinase
5ren[2] E T2V
1-[(3R)-3-(1,3-benzothiazol-2-yl)piperidin-1-yl]et..
A 100.0
/96.1
13
/13
R1AB_SARS2 3C-like proteinase
5rg2[2] E T9M
N~2~-acetyl-N-prop-2-en-1-yl-D-allothreoninamide[1..
A 100.0
/96.1
8
/8
R1AB_SARS2 3C-like proteinase
5rhf[2] F UPJ
1-acetyl-N-methyl-N-phenylpiperidine-4-carboxamide..
A 88.9
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5ref[2] E 6SU
methyl 3-(methylsulfonylamino)benzoate[15 atoms]
A 100.0
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
5rg1[2] E T9J
Nalpha-acetyl-N-(3-bromoprop-2-yn-1-yl)-L-tyrosina..
A 100.0
/96.1
14
/14
R1AB_SARS2 3C-like proteinase
5rhe[2] B UPD
1-acetyl-N-(6-methoxypyridin-3-yl)piperidine-4-car..
A 85.7
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
5rfe[2] E JGG
N-[(4-cyanophenyl)methyl]morpholine-4-carboxamide[..
A 100.0
/96.1
8
/8
R1AB_SARS2 3C-like proteinase
5rea[2] E JGP
(azepan-1-yl)(2H-1,3-benzodioxol-5-yl)methanone[18..
A 100.0
/96.1
3
/3
R1AB_SARS2 3C-like proteinase
5rg3[2] F T9P
N~2~-acetyl-N~1~-prop-2-en-1-yl-L-aspartamide[15 a..
A 100.0
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5rh4[2] B UHG
(2R)-2-(6-chloro-9H-carbazol-2-yl)propanoic acid[1..
A 80.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
5rfq[2] E T7Y
N-[3-(2-oxopyrrolidin-1-yl)phenyl]acetamide[16 ato..
A 100.0
/96.1
8
/8
R1AB_SARS2 3C-like proteinase
5ree[2] E T1M
(2R,3R)-1-benzyl-2-methylpiperidin-3-ol[15 atoms]
A 100.0
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
5rh8[2] F UHM
2-(cyanomethoxy)-N-[(1,2-thiazol-4-yl)methyl]benza..
A 100.0
/96.1
12
/12
R1AB_SARS2 3C-like proteinase
5rf9[2] E S7D
1-[(2~{S})-2-methylmorpholin-4-yl]-2-pyrazol-1-yl-..
A 100.0
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
5rec[2] E T1J
2-{[(1H-benzimidazol-2-yl)amino]methyl}phenol[18 a..
A 100.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
5rh5[2] B UHV
N-(5-tert-butyl-1,2-oxazol-3-yl)-N-[(1R)-2-[(4-met..
A 100.0
/96.1
16
/16
R1AB_SARS2 3C-like proteinase
5rej[2] E T1V
1-{4-[(thiophen-2-yl)sulfonyl]piperazin-1-yl}ethan..
A 100.0
/96.1
6
/6
R1AB_SARS2 3C-like proteinase
5rf6[2] E NTG
5-(1,4-oxazepan-4-yl)pyridine-2-carbonitrile[15 at..
A 88.9
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5r82[2] B RZS
6-(ethylamino)pyridine-3-carbonitrile[11 atoms]
A 100.0
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
5rek[2] E T1Y
1-{4-[(3-fluorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/96.1
8
/8
R1AB_SARS2 3C-like proteinase
5rh6[2] F UHY
N-[(1R)-2-[(2-ethyl-6-methylphenyl)amino]-2-oxo-1-..
A 100.0
/96.1
15
/15
R1AB_SARS2 3C-like proteinase
5rey[2] E T4Y
1-{4-[(2-methylphenyl)methyl]-1,4-diazepan-1-yl}et..
A 100.0
/96.1
10
/10
R1AB_SARS2 3C-like proteinase
6m0k[2] F FJC
~{N}-[(2~{S})-3-(3-fluorophenyl)-1-oxidanylidene-1..
A 100.0
/96.1
17
/17
R1AB_SARS2 Replicase polyprotein 1ab
5rex[2] E T4V
1-{4-[(naphthalen-1-yl)methyl]piperazin-1-yl}ethan..
A 100.0
/96.1
11
/11
R1AB_SARS2 3C-like proteinase
5rh7[2] F UJ1
N-(5-tert-butyl-1H-pyrazol-3-yl)-N-[(1R)-2-[(2-eth..
A 100.0
/96.1
15
/15
R1AB_SARS2 3C-like proteinase
5rev[2] E T4J
N-[3-(thiomorpholine-4-carbonyl)phenyl]acetamide[1..
A 100.0
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5rhb[2] G USD
(E)-1-(pyrimidin-2-yl)methanimine[8 atoms]
A 100.0
/96.1
6
/6
R1AB_SARS2 3C-like proteinase
5rew[2] E T4M
N-[(1R)-1-(naphthalen-1-yl)ethyl]acetamide[16 atom..
A 88.9
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5rf5[2] E HV2
1,1-bis(oxidanylidene)thietan-3-ol[7 atoms]
A 100.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
5reu[2] E T4D
2-[(4-acetylpiperazin-1-yl)sulfonyl]benzonitrile[2..
A 90.0
/96.1
10
/10
R1AB_SARS2 3C-like proteinase
5rgh[2] E U0M
5-fluoro-1-[(5-methyl-1,3,4-thiadiazol-2-yl)methyl..
A 90.0
/96.1
10
/10
R1AB_SARS2 3C-like proteinase
5r7z[2] E HWH
~{N}-[2-(5-fluoranyl-1~{H}-indol-3-yl)ethyl]ethana..
A 100.0
/96.1
11
/11
R1AB_SARS2 3C-like proteinase
5r83[2] E K0G
N-phenyl-N'-pyridin-3-ylurea[16 atoms]
A 100.0
/96.1
12
/12
R1AB_SARS2 3C-like proteinase
5rgk[2] E U0V
2-fluoro-N-[2-(pyridin-4-yl)ethyl]benzamide[18 ato..
A 100.0
/96.1
6
/6
R1AB_SARS2 3C-like proteinase
5rgj[2] E U0S
(5S)-7-(pyrazin-2-yl)-2-oxa-7-azaspiro[4.4]nonane[..
A 100.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
5rgi[2] E U0P
N'-cyclopropyl-N-methyl-N-[(5-methyl-1,2-oxazol-3-..
A 100.0
/96.1
11
/11
R1AB_SARS2 3C-like proteinase
5rgi[2] E U0P
N'-cyclopropyl-N-methyl-N-[(5-methyl-1,2-oxazol-3-..
A 100.0
/96.1
1
/1
R1AB_SARS2 3C-like proteinase
5rgl[2] E U0Y
1-[4-(4-methylbenzene-1-carbonyl)piperazin-1-yl]et..
A 100.0
/96.1
8
/8
R1AB_SARS2 3C-like proteinase
5rer[2] E T3J
1-[(2R)-2-(4-fluorophenyl)morpholin-4-yl]ethan-1-o..
A 100.0
/96.1
10
/10
R1AB_SARS2 3C-like proteinase
5rgn[2] E U1A
1-{4-[(4-methylphenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/96.1
8
/8
R1AB_SARS2 3C-like proteinase
5rep[2] E T3G
1-{4-[(2,6-difluorophenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/96.1
6
/6
R1AB_SARS2 3C-like proteinase
5rfc[2] E K1Y
methyl (2-methyl-4-phenyl-1,3-thiazol-5-yl)carbama..
A 83.3
/96.1
6
/6
R1AB_SARS2 3C-like proteinase
5rh3[2] B UHA
(2R)-2-(3-chlorophenyl)-N-(4-methylpyridin-3-yl)pr..
A 100.0
/96.1
14
/14
R1AB_SARS2 3C-like proteinase
5ret[2] E T47
1-{4-[(3-chlorophenyl)methyl]piperazin-1-yl}ethan-..
A 100.0
/96.1
12
/12
R1AB_SARS2 3C-like proteinase
5rgm[2] E U1D
N'-acetyl-4,5,6,7-tetrahydro-1-benzothiophene-2-ca..
A 100.0
/96.1
12
/12
R1AB_SARS2 3C-like proteinase
5rgo[2] E U1G
1-[4-(furan-2-carbonyl)piperazin-1-yl]ethan-1-one[..
A 90.9
/96.1
11
/11
R1AB_SARS2 3C-like proteinase
5rgr[2] E K1G
N,1-dimethyl-N-(propan-2-yl)-1H-pyrazolo[3,4-d]pyr..
A 100.0
/96.1
3
/3
R1AB_SARS2 3C-like proteinase
5rgr[2] D K1G
N,1-dimethyl-N-(propan-2-yl)-1H-pyrazolo[3,4-d]pyr..
A 100.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
5rgq[2] D U1V
1-(4-fluoro-2-methylphenyl)methanesulfonamide[13 a..
A 100.0
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5rgq[2] D U1V
1-(4-fluoro-2-methylphenyl)methanesulfonamide[13 a..
A 100.0
/96.1
1
/1
R1AB_SARS2 3C-like proteinase
5rfh[2] E T6Y
1-{4-[(5-chlorothiophen-2-yl)methyl]piperazin-1-yl..
A 100.0
/96.1
11
/11
R1AB_SARS2 3C-like proteinase
5rhc[2] B USA
(E)-1-(1H-imidazol-2-yl)methanimine[7 atoms]
A 100.0
/96.1
6
/6
R1AB_SARS2 3C-like proteinase
5rfg[2] E T6V
N-[(3S)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5rff[2] E T6M
1-{4-[(4-chlorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/96.1
8
/8
R1AB_SARS2 3C-like proteinase
5rfd[2] E T6J
2-[(methylsulfonyl)methyl]-1H-benzimidazole[14 ato..
A 80.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
5rgp[2] E U1M
1-{4-[(2,4-dimethylphenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/96.1
10
/10
R1AB_SARS2 3C-like proteinase
5reg[2] E LWA
(2~{S})-~{N}-(4-aminocarbonylphenyl)oxolane-2-carb..
A 87.5
/96.1
8
/8
R1AB_SARS2 3C-like proteinase
5rfv[2] E T8J
1-[4-(thiophene-2-carbonyl)piperazin-1-yl]ethan-1-..
A 90.9
/96.1
11
/11
R1AB_SARS2 3C-like proteinase
5rez[2] E T54
(1R,2S)-2-(thiophen-3-yl)cyclopentane-1-carboxamid..
A 100.0
/96.1
8
/8
R1AB_SARS2 3C-like proteinase
5rgt[2] F UHS
N-[(1R)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)..
A 100.0
/96.1
14
/14
R1AB_SARS2 3C-like proteinase
5r80[2] E RZG
methyl 4-sulfamoylbenzoate[14 atoms]
A 100.0
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5rf4[2] E T5Y
pyridin-2-ol[7 atoms]
A 75.0
/96.1
4
/4
R1AB_SARS2 3C-like proteinase
5re6[2] E O0S
N-{4-[(pyrimidin-2-yl)oxy]phenyl}acetamide[17 atom..
A 100.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
5rei[2] E T1S
4-[(3-chlorophenyl)methyl]morpholine[14 atoms]
A 100.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
5r81[2] B RZJ
1-methyl-3,4-dihydro-2~{H}-quinoline-7-sulfonamide..
A 100.0
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5rf3[2] E T5V
pyrimidin-5-amine[7 atoms]
A 100.0
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
5rgg[2] E NZD
4-methyl-N-phenylpiperazine-1-carboxamide[16 atoms..
A 100.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
5rf0[2] E T5D
[1-(pyridin-2-yl)cyclopentyl]methanol[13 atoms]
A 100.0
/96.1
4
/4
R1AB_SARS2 3C-like proteinase
5rf0[2] E T5D
[1-(pyridin-2-yl)cyclopentyl]methanol[13 atoms]
A 100.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
5rf1[2] E T5G
4-bromobenzene-1-sulfonamide[11 atoms]
A 100.0
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
5res[2] E T3V
1-{4-[(2-fluorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/96.1
6
/6
R1AB_SARS2 3C-like proteinase
5rfb[2] E K3S
N-[(1-methyl-1H-1,2,3-triazol-4-yl)methyl]ethanami..
A 100.0
/96.1
4
/4
R1AB_SARS2 3C-like proteinase
5rf7[2] E T67
1-(4-methylpiperazin-1-yl)-2-(1H-pyrrolo[2,3-b]pyr..
A 100.0
/96.1
13
/13
R1AB_SARS2 3C-like proteinase
5rhd[2] I US7
1-[4-(methylsulfonyl)phenyl]piperazine[16 atoms]
A 88.9
/96.1
9
/9
R1AB_SARS2 3C-like proteinase
5rgs[2] E S7V
[(2~{R})-4-(phenylmethyl)morpholin-2-yl]methanol[1..
A 100.0
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
6lze[2] F FHR
~{N}-[(2~{S})-3-cyclohexyl-1-oxidanylidene-1-[[(2~..
A 100.0
/96.0
17
/17
R1AB_SARS2 Replicase polyprotein 1ab
6y2f[4] C O6K
~{tert}-butyl ~{N}-[1-[(2~{S})-3-cyclopropyl-1-oxi..
A 100.0
/96.0
18
/18
R1AB_SARS2 Replicase polyprotein 1ab
6y2g[1] D O6K
~{tert}-butyl ~{N}-[1-[(2~{S})-3-cyclopropyl-1-oxi..
B 100.0
/96.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6xhl[4] C V2M
N-[(2S)-1-({(2S)-4-hydroxy-3-oxo-1-[(3S)-2-oxopyrr..
A 100.0
/100.0
18
/18
R1A_CVHSA 3C-like proteinase
6xhm[1] C V2M
N-[(2S)-1-({(2S)-4-hydroxy-3-oxo-1-[(3S)-2-oxopyrr..
B 100.0
/96.0
1
/1
R1AB_SARS2 3C-like proteinase
7c8u[6] B K36
(1S,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino..
A 100.0
/96.0
13
/13
R1AB_SARS2 Replicase polyprotein 1ab
6wtt[1] N UCS
N~2~-[(benzyloxy)carbonyl]-N-[(1R,2S)-1-hydroxy-3-..
B 100.0
/96.0
1
/1
R1AB_SARS2 3C-like proteinase
6wtt[1] N UCS
N~2~-[(benzyloxy)carbonyl]-N-[(1R,2S)-1-hydroxy-3-..
C 100.0
/96.0
20
/20
R1AB_SARS2 3C-like proteinase
7brp[2] D HU5
(1R,2S,5S)-N-[(1S)-3-AMINO-1-(CYCLOBUTYLMETHYL)-2,..
B 100.0
/96.0
16
/16
R1A_SARS2 3C-like proteinase
5rfa[2] D JGY
1-methyl-N-{[(2S)-oxolan-2-yl]methyl}-1H-pyrazole-..
A 100.0
/96.0
3
/3
R1AB_SARS2 3C-like proteinase
5rfa[2] D JGY
1-methyl-N-{[(2S)-oxolan-2-yl]methyl}-1H-pyrazole-..
A 100.0
/96.0
8
/8
R1AB_SARS2 3C-like proteinase
5ynp[5] C SFG
SINEFUNGIN[27 atoms]
A 94.1
/65.0
17
/17
K0BWD0_9BETC nsp16 protein
6wkq[2] G SFG
SINEFUNGIN[27 atoms]
A 100.0
/93.6
17
/17
R1AB_SARS2 SARS-CoV-2 NSP16
5ynq[5] C SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 94.7
/65.3
19
/19
K0BWD0_9BETC nsp16 protein
6wjt[4] F SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 100.0
/93.6
18
/18
R1AB_SARS2 2'-O-methyltransferase
5c8s[2] S SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
D 100.0
/100.0
15
/15
R1AB_CVHSA Guanine-N7 methyltransferase
6w75[5] W SAM
S-ADENOSYLMETHIONINE[27 atoms]
C 100.0
/93.5
18
/18
R1AB_SARS2 SARS-CoV-2 NSP16
7bq7[7] C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/93.3
17
/17
R1AB_SARS2 SARS-CoV-2 nsp16
7c2i[2] C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/93.3
18
/18
R1AB_SARS2 Replicase polyprotein 1ab
3r24[1] C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
19
/19
R1AB_CVHSA 2'-O-methyl transferase
5c8t[2] R SAM
S-ADENOSYLMETHIONINE[27 atoms]
D 100.0
/100.0
15
/15
R1AB_CVHSA Guanine-N7 methyltransferase
6wq3[1] E 8NK
7-methylguanosine 5'-diphosphate [29 atoms]
A 57.1
/93.3
7
/7
R1AB_SARS2 2'-O-methyltransferase
6w4h[1] G BDF
beta-D-fructopyranose[12 atoms]
A 75.0
/93.3
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
6w4h[1] J BDF
beta-D-fructopyranose[12 atoms]
A 100.0
/93.3
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
6wvn[2] P MGP
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE[33 atoms]
A 57.1
/93.3
7
/7
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] Q ADE
ADENINE[10 atoms]
A 100.0
/93.3
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] R ADE
ADENINE[10 atoms]
A 100.0
/93.3
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wks[2] D ADN
ADENOSINE[19 atoms]
A 83.3
/93.3
6
/6
R1AB_SARS2 2'-O-methyltransferase
6wlc[6] M U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms]
B 100.0
/88.7
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[6] M CMU
5-CHLORO-6-(1-(2-IMINOPYRROLIDINYL) METHYL) URACIL..
B 100.0
/88.7
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[6] O U3P
3'-URIDINEMONOPHOSPHATE[21 atoms]
B 100.0
/88.7
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
7jn2[1] B Y41
3-amino-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]..
A 100.0
/83.0
10
/10
R1A_SARS2 Papain-Like Protease
7jiv[2] B VBY
5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1..
A 100.0
/82.7
11
/11
R1A_SARS2 Papain-like protease
7jit[1] B Y95
5-[(carbamoylcarbamoyl)amino]-2-methyl-N-[(1R)-1-(..
A 100.0
/82.5
11
/11
R1A_SARS2 Papain-like protease
5ynp[6] D GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 88.2
/65.0
17
/17
K0BWD0_9BETC nsp16 protein
6wvn[3] O GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 100.0
/93.3
17
/17
R1AB_SARS2 2'-O-methyltransferase
5yni[4] D GTG
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52..
A 87.5
/65.3
16
/16
K0BWD0_9BETC nsp16 protein
5wkk[2] D AW4
(1S,2S)-2-[(N-{[2-(3-chlorophenyl)ethoxy]carbonyl}..
A 66.7
/53.7
18
/18
A0A1L2E0X0_9BETC Orf1a protein
5wkl[2] B AVY
(1R,2S)-2-{[N-({[4-benzyl-1-(tert-butoxycarbonyl)p..
A 80.0
/53.5
15
/15
A0A1L2E0X0_9BETC Orf1a protein
5wkj[2] D B1S
(1R,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino..
A 73.3
/53.5
15
/15
A0A1L2E0X0_9BETC Orf1a protein
6vh2[1] D QZ4
4,4-difluorocyclohexyl [(2S)-3-cyclohexyl-1-({(2S)..
B 73.7
/53.5
19
/19
A0A1L2E0X0_9BETC Orf1a protein
4ylu[4] M R30
N-{4-[(1H-benzotriazol-1-ylacetyl)(thiophen-3-ylme..
D 68.4
/53.2
19
/19
A0A0A7E693_9BETC ORF1a protein
4ylu[4] K R30
N-{4-[(1H-benzotriazol-1-ylacetyl)(thiophen-3-ylme..
D 100.0
/53.2
1
/1
A0A0A7E693_9BETC ORF1a protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
7073 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez[2] AA MG
MAGNESIUM ION[1 atoms]
F 100.0
/99.8
3
/3
R1AB_SARS2 nsp13
7bv2[1] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/96.8
2
/2
R1AB_SARS2 nsp12
6vww[3] E MG
MAGNESIUM ION[1 atoms]
A 100.0
/88.7
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6wuu[1] K MG
MAGNESIUM ION[1 atoms]
B 100.0
/81.9
1
/1
R1AB_SARS2 papain-like protease
6wtt[3] J MG
MAGNESIUM ION[1 atoms]
A 100.0
/96.0
2
/2
R1AB_SARS2 3C-like proteinase
2xyr[3] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6xez[1] K MG
MAGNESIUM ION[1 atoms]
A 100.0
/96.3
3
/3
R1AB_SARS2 nsp12
6wuu[1] O MG
MAGNESIUM ION[1 atoms]
D 80.0
/82.6
5
/5
R1AB_SARS2 papain-like protease
5c8t[4] Q MG
MAGNESIUM ION[1 atoms]
D 100.0
/100.0
3
/3
R1AB_CVHSA Guanine-N7 methyltransferase
6xqb[2] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/97.3
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
6wtt[1] M MG
MAGNESIUM ION[1 atoms]
B 100.0
/96.0
4
/4
R1AB_SARS2 3C-like proteinase
5c8s[2] J MG
MAGNESIUM ION[1 atoms]
B 100.0
/100.0
3
/3
R1AB_CVHSA Guanine-N7 methyltransferase
6wuu[1] P MG
MAGNESIUM ION[1 atoms]
D 100.0
/82.6
2
/2
R1AB_SARS2 papain-like protease
2fe8[6] G BR
BROMIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] F BR
BROMIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] O BR
BROMIDE ION[1 atoms]
C 100.0
/100.0
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
1uk4[2] G ATO
CHLOROACETONE[1 atoms]
B 100.0
/100.0
4
/4
R1AB_CVHSA 3C-like proteinase
2z9g[2] B HG
MERCURY (II) ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA 3C-like proteinase
5e6j[1] H NI
NICKEL (II) ION[1 atoms]
A 50.0
/99.1
2
/2
R1AB_CVHSA Replicase polyprotein 1ab
7jit[12] D ZN
ZINC ION[1 atoms]
A 100.0
/82.5
3
/3
R1A_SARS2 Papain-like protease
7jit[7] F ZN
ZINC ION[1 atoms]
A 100.0
/82.5
1
/1
R1A_SARS2 Papain-like protease
5c8u[6] E ZN
ZINC ION[1 atoms]
A 100.0
/98.5
4
/4
R1AB_CVHSA Non-structural protein 10
4ow0[40] H ZN
ZINC ION[1 atoms]
B 100.0
/100.0
5
/5
R1A_CVHSA papain-like protease
5nfy[4] R ZN
ZINC ION[1 atoms]
C 100.0
/99.8
4
/4
Q1T6X8_CVHSA Polyprotein 1ab
6wuu[5] N ZN
ZINC ION[1 atoms]
D 100.0
/82.6
4
/4
R1AB_SARS2 papain-like protease
6xqb[3] H ZN
ZINC ION[1 atoms]
A 100.0
/97.3
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
5c8u[6] L ZN
ZINC ION[1 atoms]
C 100.0
/98.5
5
/5
R1AB_CVHSA Non-structural protein 10
7c2k[3] H ZN
ZINC ION[1 atoms]
A 100.0
/96.3
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
7bw4[1] E ZN
ZINC ION[1 atoms]
A 100.0
/96.9
4
/4
R1AB_SARS2 nsp12
7bv2[3] F ZN
ZINC ION[1 atoms]
A 100.0
/96.8
4
/4
R1AB_SARS2 nsp12
5nfy[4] W ZN
ZINC ION[1 atoms]
D 100.0
/99.8
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
5wwp[6] C ZN
ZINC ION[1 atoms]
A 100.0
/72.3
4
/4
K0BWD0_9BETC ORF1ab
5wwp[6] E ZN
ZINC ION[1 atoms]
A 100.0
/72.3
4
/4
K0BWD0_9BETC ORF1ab
6xez[2] V ZN
ZINC ION[1 atoms]
F 100.0
/99.8
5
/5
R1AB_SARS2 nsp13
6w9c[3] D ZN
ZINC ION[1 atoms]
C 100.0
/83.0
1
/1
R1A_SARS2 Papain-like proteinase
6yyt[1] I ZN
ZINC ION[1 atoms]
A 100.0
/96.8
4
/4
R1AB_SARS2 nsp12
5nfy[4] N ZN
ZINC ION[1 atoms]
B 100.0
/99.8
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
6yyt[1] J ZN
ZINC ION[1 atoms]
A 100.0
/96.8
4
/4
R1AB_SARS2 nsp12
6xez[2] X ZN
ZINC ION[1 atoms]
F 100.0
/99.8
4
/4
R1AB_SARS2 nsp13
5c8s[2] I ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
2xyr[8] K ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_CVHSA NON-STRUCTURAL PROTEIN 10
2xyq[3] I ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_CVHSA NON-STRUCTURAL PROTEIN 10
6xez[3] I ZN
ZINC ION[1 atoms]
A 100.0
/96.3
4
/4
R1AB_SARS2 nsp12
5c8t[4] O ZN
ZINC ION[1 atoms]
D 100.0
/100.0
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8u[4] O ZN
ZINC ION[1 atoms]
D 100.0
/100.0
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
7jn2[2] G ZN
ZINC ION[1 atoms]
A 100.0
/83.0
2
/2
R1A_SARS2 Papain-Like Protease
5c8s[2] P ZN
ZINC ION[1 atoms]
D 100.0
/100.0
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
6nur[3] E ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA NSP12
5c8s[2] O ZN
ZINC ION[1 atoms]
D 100.0
/100.0
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
7bw4[1] F ZN
ZINC ION[1 atoms]
A 100.0
/96.9
5
/5
R1AB_SARS2 nsp12
6xez[3] J ZN
ZINC ION[1 atoms]
A 100.0
/96.3
6
/6
R1AB_SARS2 nsp12
6wjt[6] E NA
SODIUM ION[1 atoms]
A 100.0
/93.6
3
/3
R1AB_SARS2 2'-O-methyltransferase
6w75[1] U NA
SODIUM ION[1 atoms]
C 50.0
/93.5
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
2xyv[3] C NA
SODIUM ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyv[1] E NA
SODIUM ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
4ovz[3] H NA
SODIUM ION[1 atoms]
B 100.0
/100.0
5
/5
R1A_CVHSA Papain-like proteinase
5y3e[2] E NA
SODIUM ION[1 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA Replicase polyprotein 1a
5y3q[2] G NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1A_CVHSA Replicase polyprotein 1a
5y3e[2] G NA
SODIUM ION[1 atoms]
A 100.0
/100.0
7
/7
R1A_CVHSA Replicase polyprotein 1a
6xbg[1] H NA
SODIUM ION[1 atoms]
B 100.0
/96.0
1
/1
R1AB_SARS2 main protease
5y3q[2] E NA
SODIUM ION[1 atoms]
A 100.0
/100.0
5
/5
R1A_CVHSA Replicase polyprotein 1a
2xyq[2] G NA
SODIUM ION[1 atoms]
A 100.0
/100.0
6
/6
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6z2e[2] E NA
SODIUM ION[1 atoms]
A 100.0
/96.1
4
/4
R1AB_SARS2 Main Protease
6w75[1] T NA
SODIUM ION[1 atoms]
C 100.0
/93.5
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[3] V NA
SODIUM ION[1 atoms]
C 100.0
/93.5
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
6xbi[1] G NA
SODIUM ION[1 atoms]
A 100.0
/96.1
3
/3
R1AB_SARS2 main protease
6x4i[3] P NA
SODIUM ION[1 atoms]
B 100.0
/88.7
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
4m0w[1] D NA
SODIUM ION[1 atoms]
A 80.0
/99.7
5
/5
R1A_CVHSA Replicase polyprotein 1a
6xbh[2] D NA
SODIUM ION[1 atoms]
A 100.0
/96.1
3
/3
R1AB_SARS2 main protease
6wtt[1] O CL
CHLORIDE ION[1 atoms]
C 100.0
/96.0
1
/1
R1AB_SARS2 3C-like proteinase
6wtt[1] L CL
CHLORIDE ION[1 atoms]
B 50.0
/96.0
2
/2
R1AB_SARS2 3C-like proteinase
7jit[10] I CL
CHLORIDE ION[1 atoms]
A 100.0
/82.5
1
/1
R1A_SARS2 Papain-like protease
6xkf[11] D CL
CHLORIDE ION[1 atoms]
A 100.0
/96.1
2
/2
R1AB_SARS2 3C-like proteinase
6wtt[2] I CL
CHLORIDE ION[1 atoms]
A 100.0
/96.0
1
/1
R1AB_SARS2 3C-like proteinase
2xyv[3] H CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wtt[15] G CL
CHLORIDE ION[1 atoms]
A 100.0
/96.0
1
/1
R1AB_SARS2 3C-like proteinase
5r7y[3] G CL
CHLORIDE ION[1 atoms]
A 100.0
/96.1
4
/4
R1AB_SARS2 3C-like proteinase
6wvn[2] DA CL
CHLORIDE ION[1 atoms]
A 100.0
/93.3
1
/1
R1AB_SARS2 2'-O-methyltransferase
6yt8[2] G CL
CHLORIDE ION[1 atoms]
A 100.0
/96.1
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
6wzu[8] G CL
CHLORIDE ION[1 atoms]
A 100.0
/82.9
6
/6
R1AB_SARS2 Non-structural protein 3
7c7p[1] D CL
CHLORIDE ION[1 atoms]
A 100.0
/96.0
3
/3
R1AB_SARS2 main protease
6vww[3] L CL
CHLORIDE ION[1 atoms]
B 100.0
/88.7
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6yvf[2] D CL
CHLORIDE ION[1 atoms]
A 100.0
/96.1
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
6yvf[2] D CL
CHLORIDE ION[1 atoms]
A 100.0
/96.1
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
2xyr[3] L CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_CVHSA NON-STRUCTURAL PROTEIN 10
2xyr[2] F CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6z2e[2] D CL
CHLORIDE ION[1 atoms]
A 80.0
/96.1
5
/5
R1AB_SARS2 Main Protease
2a5a[2] B CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_CVHSA 3C-like peptidase
7jir[2] J CL
CHLORIDE ION[1 atoms]
A 100.0
/82.4
3
/3
R1A_SARS2 Papain-like protease
3e9s[1] E CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1A_CVHSA Non-structural protein 3
6wrz[4] O CL
CHLORIDE ION[1 atoms]
A 100.0
/93.3
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] D CL
CHLORIDE ION[1 atoms]
A 100.0
/93.3
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] K CL
CHLORIDE ION[1 atoms]
A 100.0
/93.3
2
/2
R1AB_SARS2 2'-O-methyltransferase
2xyq[3] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wvn[1] G CL
CHLORIDE ION[1 atoms]
A 100.0
/93.3
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wzu[3] F CL
CHLORIDE ION[1 atoms]
A 100.0
/82.9
3
/3
R1AB_SARS2 Non-structural protein 3
6yvf[2] C CL
CHLORIDE ION[1 atoms]
A 100.0
/96.1
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
6xkm[1] C CL
CHLORIDE ION[1 atoms]
A 100.0
/93.3
3
/3
R1AB_SARS2 2'-O-methyltransferase
6w61[1] C CL
CHLORIDE ION[1 atoms]
A 100.0
/93.3
3
/3
R1AB_SARS2 2'-O-methyltransferase
2xyv[1] I CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wrz[1] P CL
CHLORIDE ION[1 atoms]
A 100.0
/93.3
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] C CL
CHLORIDE ION[1 atoms]
A 100.0
/93.3
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] H CL
CHLORIDE ION[1 atoms]
A 33.3
/93.3
3
/3
R1AB_SARS2 2'-O-methyltransferase
7jn2[2] N UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/83.0
1
/1
R1A_SARS2 Papain-Like Protease
6yvf[2] L CA
CALCIUM ION[1 atoms]
A 100.0
/96.1
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
5wkj[2] C CA
CALCIUM ION[1 atoms]
A 100.0
/53.5
1
/1
A0A1L2E0X0_9BETC Orf1a protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
7073 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1qz8[4] B R1AB_CVHSA polyprotein 1ab[110 aa] A 100.0
/100.0
17
/17
R1AB_CVHSA polyprotein 1ab
1uw7[2] A R1AB_CVHSA NSP9[122 aa] A 87.5
/92.6
24
/24
R1AB_CVHSA NSP9
1qz8[2] A R1AB_CVHSA polyprotein 1ab[111 aa] A 100.0
/100.0
6
/6
R1AB_CVHSA polyprotein 1ab
2fe8[8] C R1AB_CVHSA Replicase polyprotein 1ab[313 aa] A 100.0
/100.0
18
/18
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] A 100.0
/100.0
23
/23
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] A 100.0
/100.0
8
/9
R1AB_CVHSA Replicase polyprotein 1ab
2ahm[6] E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] G 100.0
/100.0
7
/7
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[12] H R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] F 100.0
/100.0
6
/6
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[4] G R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] E 100.0
/100.0
8
/8
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[4] E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] G 100.0
/100.0
7
/7
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[2] E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] H 100.0
/100.0
7
/7
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
3ebn[4] D R1AB_CVHSA Replicase polyprotein 1ab[101 aa] B 100.0
/100.0
59
/59
R1AB_CVHSA Replicase polyprotein 1ab
6xez[1] E R1AB_SARS2 nsp13[596 aa] F 100.0
/99.8
5
/5
R1AB_SARS2 nsp13
6xez[1] F R1AB_SARS2 nsp13[596 aa] E 100.0
/99.8
4
/4
R1AB_SARS2 nsp13
5rgm[520] A R1AB_SARS2 3C-like proteinase[304 aa] A 94.6
/96.1
37
/37
R1AB_SARS2 3C-like proteinase
3iwm[8] A R1A_CVHSA 3C-like proteinase[301 aa] B 100.0
/100.0
2
/2
R1A_CVHSA 3C-like proteinase
3iwm[4] C R1A_CVHSA 3C-like proteinase[300 aa] C 100.0
/100.0
7
/7
R1A_CVHSA 3C-like proteinase
2gtb[2] A R1AB_CVHSA 3C-like proteinase[299 aa] A 100.0
/100.0
2
/2
R1AB_CVHSA 3C-like proteinase
3iwm[8] B R1A_CVHSA 3C-like proteinase[301 aa] C 100.0
/100.0
4
/4
R1A_CVHSA 3C-like proteinase
3iwm[8] B R1A_CVHSA 3C-like proteinase[301 aa] C 100.0
/100.0
4
/4
R1A_CVHSA 3C-like proteinase
3iwm[8] D R1A_CVHSA 3C-like proteinase[300 aa] B 100.0
/100.0
78
/78
R1A_CVHSA 3C-like proteinase
2z3e[2] A R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)[306 aa] A 100.0
/100.0
5
/5
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
2wct[6] C R1A_CVHSA NON-STRUCTURAL PROTEIN 3[252 aa] B 100.0
/99.6
24
/24
R1A_CVHSA NON-STRUCTURAL PROTEIN 3
2rhb[12] F R1AB_CVHSA Uridylate-specific endoribonuclease[344 aa] D 100.0
/99.7
30
/30
R1AB_CVHSA Uridylate-specific endoribonuclease
2ozk[4] D R1AB_CVHSA Uridylate-specific endoribonuclease[296 aa] B 100.0
/100.0
13
/13
R1AB_CVHSA Uridylate-specific endoribonuclease
2rhb[6] C R1AB_CVHSA Uridylate-specific endoribonuclease[345 aa] F 100.0
/99.7
14
/14
R1AB_CVHSA Uridylate-specific endoribonuclease
2ozk[2] A R1AB_CVHSA Uridylate-specific endoribonuclease[306 aa] B 100.0
/100.0
31
/31
R1AB_CVHSA Uridylate-specific endoribonuclease
2h85[6] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 100.0
/99.4
15
/16
Q6VA80_CVHSA Putative orf1ab polyprotein
2h85[6] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 96.3
/99.4
27
/27
Q6VA80_CVHSA Putative orf1ab polyprotein
2rhb[6] F R1AB_CVHSA Uridylate-specific endoribonuclease[344 aa] E 100.0
/99.7
25
/25
R1AB_CVHSA Uridylate-specific endoribonuclease
2ozk[2] B R1AB_CVHSA Uridylate-specific endoribonuclease[305 aa] D 100.0
/100.0
20
/20
R1AB_CVHSA Uridylate-specific endoribonuclease
2ozk[2] C R1AB_CVHSA Uridylate-specific endoribonuclease[291 aa] B 100.0
/100.0
3
/3
R1AB_CVHSA Uridylate-specific endoribonuclease
2ahm[8] C R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] B 100.0
/96.1
4
/4
R1AB_CVHSA Replicase polyprotein 1ab, light chain
6wks[2] A R1AB_SARS2 2'-O-methyltransferase[298 aa] A 88.2
/93.3
17
/17
R1AB_SARS2 2'-O-methyltransferase
6x4i[42] A R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] A 82.8
/88.7
29
/29
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[42] B R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] B 91.7
/88.7
24
/24
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[36] B R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] A 93.3
/88.7
15
/17
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[12] A R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] B 100.0
/88.7
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6w9c[6] A R1A_SARS2 Papain-like proteinase[313 aa] C 100.0
/83.0
3
/3
R1A_SARS2 Papain-like proteinase
6xg3[2] A R1AB_SARS2 Peptidase C16[313 aa] A 79.2
/82.4
24
/24
R1AB_SARS2 Peptidase C16
5wkj[9] A A0A1L2E0X0_9BETC Orf1a protein[302 aa] A 63.3
/53.5
30
/31
A0A1L2E0X0_9BETC Orf1a protein
4ylu[10] C A0A0A7E693_9BETC ORF1a protein[302 aa] D 67.6
/53.2
34
/34
A0A0A7E693_9BETC ORF1a protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
7073 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2z9g[2] C BNZ
BENZENE[6 atoms]
A 100.0
/100.0
7
/7
R1AB_CVHSA 3C-like proteinase
2z9k[2] E DOZ
(dimethylamino)(hydroxy)zinc'[5 atoms]
A 100.0
/100.0
5
/5
R1AB_CVHSA 3C-like proteinase
2z9j[2] E DTZ
zinc(II)hydrogensulfide[3 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA 3C-like proteinase
5y3q[1] C BME
BETA-MERCAPTOETHANOL[4 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA Replicase polyprotein 1a
2z9l[2] E DAZ
diaminozinc[3 atoms]
A 100.0
/100.0
2
/2
R1AB_CVHSA 3C-like proteinase
6vww[3] N GOL
GLYCEROL[6 atoms]
B 100.0
/88.7
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[6] F GOL
GLYCEROL[6 atoms]
A 75.0
/88.7
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
2acf[5] H GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
9
/9
Replicase polyprotein 1ab
2ahm[20] M GOL
GLYCEROL[6 atoms]
F 100.0
/100.0
3
/3
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
6vww[6] G GOL
GLYCEROL[6 atoms]
A 80.0
/88.7
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6xbi[1] F GOL
GLYCEROL[6 atoms]
A 100.0
/96.1
3
/3
R1AB_SARS2 main protease
6wtt[2] F GOL
GLYCEROL[6 atoms]
A 100.0
/96.0
4
/4
R1AB_SARS2 3C-like proteinase
6xa9[20] I GOL
GLYCEROL[6 atoms]
A 100.0
/82.7
5
/5
R1AB_SARS2 Papain-like protease
4ow0[1] F GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1A_CVHSA papain-like protease
5y3e[2] I GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA Replicase polyprotein 1a
6wrh[2] I GOL
GLYCEROL[6 atoms]
A 100.0
/82.5
6
/6
R1AB_SARS2 Non-structural protein 3
5y3e[1] J GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1A_CVHSA Replicase polyprotein 1a
6vww[3] I GOL
GLYCEROL[6 atoms]
B 100.0
/88.7
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
2acf[1] F GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
Replicase polyprotein 1ab
2ahm[6] I GOL
GLYCEROL[6 atoms]
E 100.0
/100.0
1
/1
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[7] I GOL
GLYCEROL[6 atoms]
E 100.0
/100.0
2
/2
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
6vww[3] D GOL
GLYCEROL[6 atoms]
A 100.0
/88.7
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
2acf[1] K GOL
GLYCEROL[6 atoms]
C 100.0
/100.0
4
/4
Replicase polyprotein 1ab
2z3e[2] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
5y3e[3] H GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA Replicase polyprotein 1a
6vww[3] C GOL
GLYCEROL[6 atoms]
A 100.0
/88.7
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
2acf[1] N GOL
GLYCEROL[6 atoms]
C 100.0
/100.0
2
/2
Replicase polyprotein 1ab
3vb4[1] K GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
R1A_CVHSA 3C-like proteinase
6xbi[1] E GOL
GLYCEROL[6 atoms]
A 100.0
/96.1
4
/4
R1AB_SARS2 main protease
3vb7[1] H GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
6
/6
R1A_CVHSA 3C-like proteinase
6xa9[3] G GOL
GLYCEROL[6 atoms]
A 80.0
/82.7
5
/5
R1AB_SARS2 Papain-like protease
2ahm[4] L GOL
GLYCEROL[6 atoms]
B 100.0
/96.1
1
/1
R1AB_CVHSA Replicase polyprotein 1ab, light chain
6wrh[2] H GOL
GLYCEROL[6 atoms]
A 100.0
/82.5
3
/3
R1AB_SARS2 Non-structural protein 3
2acf[1] P GOL
GLYCEROL[6 atoms]
D 100.0
/100.0
2
/2
Replicase polyprotein 1ab
2acf[1] J GOL
GLYCEROL[6 atoms]
C 100.0
/100.0
7
/7
Replicase polyprotein 1ab
2acf[1] L GOL
GLYCEROL[6 atoms]
C 100.0
/100.0
2
/2
Replicase polyprotein 1ab
3snd[1] E MRD
(4R)-2-METHYLPENTANE-2,4-DIOL[8 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA 3C-like proteinase
1q2w[1] C MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 100.0
/100.0
5
/5
R1A_CVHSA 3C-like protease
2v6n[6] C MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
5
/5
R1AB_CVHSA REPLICASE POLYPROTEIN 1AB
6wco[2] C MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
3
/3
A0A3G5BIY8_CVHSA Main protease
7jir[3] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/82.4
3
/3
R1A_SARS2 Papain-like protease
7jiw[1] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 83.3
/82.6
6
/6
R1A_SARS2 Papain-Like Protease
2gt7[1] C MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
B 100.0
/100.0
1
/1
R1AB_CVHSA 3C-like proteinase
6yz1[1] D MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/93.3
5
/5
R1AB_SARS2 nsp16
6xez[2] Z AF3
ALUMINUM FLUORIDE[4 atoms]
F 100.0
/99.8
6
/6
R1AB_SARS2 nsp13
6zsl[4] K PO4
PHOSPHATE ION[5 atoms]
B 100.0
/99.8
7
/7
R1AB_SARS2 SARS-CoV-2 helicase NSP13
6xg3[3] C PO4
PHOSPHATE ION[5 atoms]
A 83.3
/82.4
6
/6
R1AB_SARS2 Peptidase C16
6wrh[2] D PO4
PHOSPHATE ION[5 atoms]
A 50.0
/82.5
2
/2
R1AB_SARS2 Non-structural protein 3
6wzu[2] E PO4
PHOSPHATE ION[5 atoms]
A 80.0
/82.9
5
/5
R1AB_SARS2 Non-structural protein 3
6wxc[12] N PO4
PHOSPHATE ION[5 atoms]
B 100.0
/88.7
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
7bv2[1] H POP
PYROPHOSPHATE 2-[9 atoms]
A 100.0
/96.8
3
/3
R1AB_SARS2 nsp12
5nfy[2] T PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
C 100.0
/99.8
1
/1
Q1T6X8_CVHSA Polyprotein 1ab
6yvf[2] K PEG
DI(HYDROXYETHYL)ETHER[6 atoms]
A 100.0
/96.1
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6yt8[2] E PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/96.1
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
6w01[6] AA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 100.0
/88.7
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6yvf[2] J PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/96.1
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
6w01[3] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/88.7
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
6yvf[2] I PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 75.0
/96.1
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
3vb3[2] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
4
/4
R1A_CVHSA 3C-like proteinase
6yt8[2] F PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 85.7
/96.1
7
/7
R1AB_SARS2 Replicase polyprotein 1ab
6wtt[2] E PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/96.0
4
/4
R1AB_SARS2 3C-like proteinase
3vb4[3] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1A_CVHSA 3C-like proteinase
3vb4[4] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
R1A_CVHSA 3C-like proteinase
3vb3[1] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA 3C-like proteinase
3vb3[2] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1A_CVHSA 3C-like proteinase
3vb4[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
R1A_CVHSA 3C-like proteinase
6wlc[3] J EDO
1,2-ETHANEDIOL[4 atoms]
A 85.7
/88.7
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
3vb3[6] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA 3C-like proteinase
4wme[1] T EDO
1,2-ETHANEDIOL[4 atoms]
D 33.3
/52.6
6
/6
W6A941_9BETC MERS-CoV 3CL protease
6wlc[9] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/88.7
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[41] CA EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/88.7
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6xhn[42] D EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1A_CVHSA 3C-like proteinase
3vb4[17] H EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1A_CVHSA 3C-like proteinase
6xkh[2] B EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/96.1
4
/4
R1AB_SARS2 3C-like proteinase
6wlc[29] P EDO
1,2-ETHANEDIOL[4 atoms]
B 80.0
/88.7
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[6] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/88.7
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
4wme[11] E EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/52.6
6
/6
W6A941_9BETC MERS-CoV 3CL protease
4wme[4] G EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/52.6
4
/4
W6A941_9BETC MERS-CoV 3CL protease
4wme[1] J EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/52.6
4
/4
W6A941_9BETC MERS-CoV 3CL protease
6xdh[24] L EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/88.7
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6x1b[3] G EDO
1,2-ETHANEDIOL[4 atoms]
B 66.7
/88.7
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[3] X EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/88.7
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[15] U EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/88.7
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[6] S EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/88.7
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[6] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/88.7
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] L EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/88.7
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[6] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/88.7
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[12] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/88.7
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] M EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/88.7
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[3] H EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/88.7
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[12] F EDO
1,2-ETHANEDIOL[4 atoms]
A 87.5
/88.7
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[3] G EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/88.7
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
3vb7[3] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1A_CVHSA 3C-like proteinase
6xkh[2] C EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/96.1
3
/3
R1AB_SARS2 3C-like proteinase
3vb4[1] L EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1A_CVHSA 3C-like proteinase
3vb3[1] I EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1A_CVHSA 3C-like proteinase
6xkf[1] C EDO
1,2-ETHANEDIOL[4 atoms]
A 80.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
4wme[1] K EDO
1,2-ETHANEDIOL[4 atoms]
A 60.0
/52.6
5
/5
W6A941_9BETC MERS-CoV 3CL protease
6w61[1] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/93.3
7
/7
R1AB_SARS2 2'-O-methyltransferase
6w01[3] S EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/88.7
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
4wme[1] I EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/52.6
4
/7
W6A941_9BETC MERS-CoV 3CL protease
5rg3[240] B DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.1
3
/3
R1AB_SARS2 3C-like proteinase
5rf1[250] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
5rf1[252] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.1
1
/1
R1AB_SARS2 3C-like proteinase
5rgy[12] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.1
1
/1
R1AB_SARS2 3C-like proteinase
5rgy[64] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
5rgx[48] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
6xbi[1] H DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/96.0
5
/5
R1AB_SARS2 main protease
5rg3[236] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.1
4
/4
R1AB_SARS2 3C-like proteinase
6lze[16] B DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.0
7
/7
R1AB_SARS2 Replicase polyprotein 1ab
4ow0[1] J DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/100.0
2
/2
R1A_CVHSA papain-like protease
5rfw[18] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 83.3
/96.1
6
/6
R1AB_SARS2 3C-like proteinase
4ovz[1] J DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/100.0
3
/3
R1A_CVHSA Papain-like proteinase
5red[16] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 66.7
/96.1
3
/3
R1AB_SARS2 3C-like proteinase
4mds[16] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
R1A_CVHSA 3C-like proteinase
6yvf[6] H DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.1
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
4ovz[3] K DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/100.0
4
/4
R1A_CVHSA Papain-like proteinase
7buy[2] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.1
4
/4
SARS-CoV-2 virus Main protease
7buy[2] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.1
2
/2
SARS-CoV-2 virus Main protease
4ovz[1] L DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/100.0
6
/6
R1A_CVHSA Papain-like proteinase
6yz6[2] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.1
4
/4
R1AB_SARS2 Main Protease
6m0k[2] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.1
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
3tiu[2] B DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA SARS coronavirus main protease
2vj1[3] F DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/100.0
3
/3
A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
4ow0[1] G DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1A_CVHSA papain-like protease
2vj1[1] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
1
/1
A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
6yt8[2] C IMD
IMIDAZOLE[5 atoms]
A 100.0
/96.1
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
6yz6[2] E IMD
IMIDAZOLE[5 atoms]
A 66.7
/96.1
3
/3
R1AB_SARS2 Main Protease
5rf2[2] E HVB
1-azanylpropylideneazanium[5 atoms]
A 80.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
6y2g[1] C GLY
GLYCINE[4 atoms]
B 100.0
/96.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6y2g[1] C GLY
GLYCINE[4 atoms]
A 100.0
/96.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
6w75[3] O FMT
FORMIC ACID[3 atoms]
A 80.0
/93.6
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6xdh[3] I FMT
FORMIC ACID[3 atoms]
B 100.0
/88.7
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6w75[13] H FMT
FORMIC ACID[3 atoms]
A 100.0
/93.6
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[6] J FMT
FORMIC ACID[3 atoms]
A 100.0
/93.6
6
/6
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[3] L FMT
FORMIC ACID[3 atoms]
A 100.0
/93.6
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[2] DA FMT
FORMIC ACID[3 atoms]
C 100.0
/93.5
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
6xkh[5] D FMT
FORMIC ACID[3 atoms]
A 100.0
/96.1
5
/5
R1AB_SARS2 3C-like proteinase
6xdh[3] G FMT
FORMIC ACID[3 atoms]
B 100.0
/88.7
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wkq[4] L FMT
FORMIC ACID[3 atoms]
A 100.0
/93.6
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6wkq[2] H FMT
FORMIC ACID[3 atoms]
A 100.0
/93.6
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
6xdh[3] F FMT
FORMIC ACID[3 atoms]
A 87.5
/88.7
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] U FMT
FORMIC ACID[3 atoms]
B 100.0
/88.7
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] U FMT
FORMIC ACID[3 atoms]
B 100.0
/88.7
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[6] Q FMT
FORMIC ACID[3 atoms]
B 100.0
/88.7
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
7jfq[2] E FMT
FORMIC ACID[3 atoms]
A 100.0
/96.1
2
/2
R1AB_SARS2 3C-like proteinase
6xdh[3] M FMT
FORMIC ACID[3 atoms]
B 100.0
/88.7
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wjt[1] K FMT
FORMIC ACID[3 atoms]
A 100.0
/93.6
4
/4
R1AB_SARS2 2'-O-methyltransferase
6xdh[6] E FMT
FORMIC ACID[3 atoms]
A 66.7
/88.7
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[3] P FMT
FORMIC ACID[3 atoms]
B 75.0
/88.7
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6w75[5] FA FMT
FORMIC ACID[3 atoms]
C 100.0
/93.5
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[3] AA FMT
FORMIC ACID[3 atoms]
C 100.0
/93.5
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
6wlc[4] V FMT
FORMIC ACID[3 atoms]
B 0.0
/88.7
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6xkh[2] E FMT
FORMIC ACID[3 atoms]
A 100.0
/96.1
3
/3
R1AB_SARS2 3C-like proteinase
6xkh[2] F FMT
FORMIC ACID[3 atoms]
A 85.7
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
6w75[1] KA FMT
FORMIC ACID[3 atoms]
C 100.0
/93.5
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
6xkh[2] G FMT
FORMIC ACID[3 atoms]
A 100.0
/96.1
3
/3
R1AB_SARS2 3C-like proteinase
6w75[2] CA FMT
FORMIC ACID[3 atoms]
C 83.3
/93.5
6
/6
R1AB_SARS2 SARS-CoV-2 NSP16
7jfq[2] C FMT
FORMIC ACID[3 atoms]
A 100.0
/96.1
7
/7
R1AB_SARS2 3C-like proteinase
6wjt[1] L FMT
FORMIC ACID[3 atoms]
A 100.0
/93.6
5
/5
R1AB_SARS2 2'-O-methyltransferase
6wjt[1] P FMT
FORMIC ACID[3 atoms]
A 100.0
/93.6
1
/1
R1AB_SARS2 2'-O-methyltransferase
6w4h[1] C SO3
SULFITE ION[4 atoms]
A 100.0
/93.3
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
1qz8[4] D SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1AB_CVHSA polyprotein 1ab
1qz8[8] D SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1AB_CVHSA polyprotein 1ab
6wvn[1] Z SO4
SULFATE ION[5 atoms]
A 100.0
/93.3
4
/4
R1AB_SARS2 2'-O-methyltransferase
2v6n[2] D SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_CVHSA REPLICASE POLYPROTEIN 1AB
2fe8[6] M SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
1qz8[4] F SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
2
/2
R1AB_CVHSA polyprotein 1ab
6wq3[2] K SO4
SULFATE ION[5 atoms]
A 100.0
/93.3
1
/1
R1AB_SARS2 2'-O-methyltransferase
5wwp[6] L SO4
SULFATE ION[5 atoms]
B 100.0
/72.8
5
/5
K0BWD0_9BETC ORF1ab
6wq3[6] J SO4
SULFATE ION[5 atoms]
A 100.0
/93.3
2
/2
R1AB_SARS2 2'-O-methyltransferase
2w2g[2] D SO4
SULFATE ION[5 atoms]
B 66.7
/99.6
3
/3
R1A_CVHSA NON-STRUCTURAL PROTEIN 3
6wlc[3] L SO4
SULFATE ION[5 atoms]
A 100.0
/88.7
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
5tl6[1] F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
6wvn[3] U SO4
SULFATE ION[5 atoms]
A 100.0
/93.3
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] Y SO4
SULFATE ION[5 atoms]
A 100.0
/93.3
2
/2
R1AB_SARS2 2'-O-methyltransferase
1qz8[2] E SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_CVHSA polyprotein 1ab
6wrz[4] F SO4
SULFATE ION[5 atoms]
A 100.0
/93.3
1
/1
R1AB_SARS2 2'-O-methyltransferase
2ahm[2] N SO4
SULFATE ION[5 atoms]
H 100.0
/100.0
4
/4
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
5wwp[1] J SO4
SULFATE ION[5 atoms]
B 100.0
/72.8
6
/6
K0BWD0_9BETC ORF1ab
5wwp[1] K SO4
SULFATE ION[5 atoms]
B 100.0
/72.8
4
/4
K0BWD0_9BETC ORF1ab
6wrz[1] L SO4
SULFATE ION[5 atoms]
A 100.0
/93.3
1
/1
R1AB_SARS2 2'-O-methyltransferase
4ylu[7] G ACT
ACETATE ION[4 atoms]
A 50.0
/53.2
2
/2
A0A0A7E693_9BETC ORF1a protein
6xdh[3] K ACT
ACETATE ION[4 atoms]
B 100.0
/88.7
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[6] H ACT
ACETATE ION[4 atoms]
B 100.0
/88.7
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
7jit[3] K ACT
ACETATE ION[4 atoms]
A 85.7
/82.5
7
/7
R1A_SARS2 Papain-like protease
6wlc[4] T ACT
ACETATE ION[4 atoms]
B 100.0
/88.7
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] Q ACT
ACETATE ION[4 atoms]
B 87.5
/88.7
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[6] C ACT
ACETATE ION[4 atoms]
A 100.0
/88.7
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6w4h[1] E ACT
ACETATE ION[4 atoms]
A 100.0
/93.3
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6wlc[3] F ACT
ACETATE ION[4 atoms]
A 100.0
/88.7
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
4ylu[1] J ACT
ACETATE ION[4 atoms]
B 100.0
/53.0
2
/2
A0A0A7E693_9BETC ORF1a protein
6xkh[2] H ACT
ACETATE ION[4 atoms]
A 100.0
/96.1
4
/4
R1AB_SARS2 3C-like proteinase
4ylu[2] F ACT
ACETATE ION[4 atoms]
A 20.0
/53.2
5
/5
A0A0A7E693_9BETC ORF1a protein
6w4h[1] F ACT
ACETATE ION[4 atoms]
A 100.0
/93.3
7
/7
R1AB_SARS2 SARS-CoV-2 NSP16
7jn2[1] L ACT
ACETATE ION[4 atoms]
A 100.0
/83.0
2
/2
R1A_SARS2 Papain-Like Protease
2gtb[2] C ACY
ACETIC ACID[4 atoms]
A 100.0
/100.0
5
/5
R1AB_CVHSA 3C-like proteinase
6vww[3] O ACY
ACETIC ACID[4 atoms]
B 83.3
/88.7
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] H ACY
ACETIC ACID[4 atoms]
A 66.7
/88.7
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] P ACY
ACETIC ACID[4 atoms]
B 87.5
/88.7
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] N TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
B 100.0
/88.7
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[6] N TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
B 75.0
/88.7
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[12] N CIT
CITRIC ACID[13 atoms]
A 100.0
/88.7
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
5wkk[2] B PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 25.0
/53.7
4
/4
A0A1L2E0X0_9BETC Orf1a protein
5wkk[2] B PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 50.0
/53.7
2
/2
A0A1L2E0X0_9BETC Orf1a protein
6xmk[1] E PG4
TETRAETHYLENE GLYCOL[13 atoms]
B 100.0
/96.0
8
/8
R1AB_SARS2 3C-like proteinase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.