[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
54804 1273 298 P0DTC2(SPIKE_WCPV) RecName: Full=Spike glycoprotein; Short=S glycoprotein;AltName: Full=E2;AltName: Full=Peplomer protein;Contains: RecName: Full=Spike protein S1;Contains: RecName: Full=Spike protein S2;Contains: RecName: Full=Spike protein S2';Flags: Precursor;
QUERYSEQ
MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNK
SWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK
CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN
YLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP
GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECS
NLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM
QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLM
SFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL
QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTC2(SPIKE_WCPV)]

1273
region name description
1-13 SIGNAL
14-1273 CHAIN /note="Spike glycoprotein" /id="PRO_0000449646"
14-685 CHAIN /note="Spike protein S1" /id="PRO_0000449647"
686-1273 CHAIN /note="Spike protein S2" /id="PRO_0000449648"
816-1273 CHAIN /note="Spike protein S2'" /id="PRO_0000449649"
1214-1234 TRANSMEM /note="Helical"
319-541 REGION /note="Receptor-binding domain"
437-508 REGION /note="Receptor-binding motif; binding to human ACE2"
788-806 REGION /note="Fusion peptide"
920-970 REGION /note="Heptad repeat 1"
1163-1202 REGION /note="Heptad repeat 2"
1176-1203 COILED
1-1273 DISORDER predicted by DISOPRED (1-26,679-687,1021-1021,1024-1024,1271-1273)

MONOMER
1273
pdb_id a1 identity[%]2 description
6vsb B 99.8 Spike glycoprotein
6b3o B 43.2 SPIKE_CVMA5 Spike glycoprotein
1wyy A 92.9 SPIKE_CVHSA E2 Glycoprotein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6w41[1] A CR3022 Fab heavy chain[222 aa] C 100.0
/100.0
15
/15
Spike glycoprotein receptor binding domain
6w41[1] B CR3022 Fab light chain[221 aa] C 100.0
/100.0
9
/9
Spike glycoprotein receptor binding domain
2bez[6] A VGL2_CVHSA E2 GLYCOPROTEIN[77 aa] B 100.0
/100.0
27
/27
VGL2_CVHSA E2 GLYCOPROTEIN
1zv8[12] G VGL2_CVHSA E2 glycoprotein[50 aa] L 100.0
/100.0
21
/21
VGL2_CVHSA E2 glycoprotein
6m17[2] B ACE2_HUMAN Angiotensin-converting enzyme 2[748 aa] C 100.0
/100.0
16
/16
2019-nCoV Receptor Binding Domain
2beq[12] C VGL2_CVHSA E2 GLYCOPROTEIN[38 aa] E 100.0
/100.0
19
/19
VGL2_CVHSA E2 GLYCOPROTEIN
2beq[2] B VGL2_CVHSA E2 GLYCOPROTEIN[38 aa] F 100.0
/100.0
2
/2
VGL2_CVHSA E2 GLYCOPROTEIN
5zvk[6] D pan-CoV inhibitory peptide EK1[30 aa] A 56.2
/55.7
16
/16
W6A0A7_9BETC Human Coronavirus MERS HR1 motif
5zvk[6] E pan-CoV inhibitory peptide EK1[31 aa] C 43.8
/55.7
16
/16
W6A0A7_9BETC Human Coronavirus MERS HR1 motif
2beq[15] E VGL2_CVHSA E2 GLYCOPROTEIN[47 aa] B 75.0
/80.6
16
/16
VGL2_CVHSA E2 GLYCOPROTEIN
2beq[15] F VGL2_CVHSA E2 GLYCOPROTEIN[48 aa] A 80.0
/80.6
15
/15
VGL2_CVHSA E2 GLYCOPROTEIN
2beq[2] F VGL2_CVHSA E2 GLYCOPROTEIN[48 aa] B 0.0
/80.6
2
/3
VGL2_CVHSA E2 GLYCOPROTEIN
6nb7[5] I S230 light chain[110 aa] A 0.0
/77.8
3
/3
SPIKE_CVHSA Spike glycoprotein
6nb6[1] E S230 heavy chain[124 aa] B 100.0
/78.3
1
/1
SPIKE_CVHSA Spike glycoprotein
6nb6[1] D S230 heavy chain[123 aa] C 100.0
/77.7
1
/1
SPIKE_CVHSA Spike glycoprotein
3sck[14] A ACE2_PAGLA ACE2_HUMAN Angiotensin-converting enzyme 2 chimera[597 aa] C 47.4
/72.3
19
/19
SPIKE_CVHSA Spike glycoprotein
6m0j[6] A ACE2_HUMAN Angiotensin-converting enzyme 2[597 aa] B 100.0
/100.0
17
/17
2019-nCoV receptor-binding domain
6ack[3] D ACE2_HUMAN Angiotensin-converting enzyme 2[597 aa] C 53.8
/76.7
13
/13
SPIKE_CVHSA Spike glycoprotein
6cs2[1] D ACE2_HUMAN Angiotensin-converting enzyme 2[544 aa] B 42.1
/76.3
19
/19
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
2dd8[1] A Q6PJF1_HUMAN IGG Heavy Chain[220 aa] C 53.8
/74.0
13
/13
SPIKE_CVHSA Spike glycoprotein
2dd8[1] A Q6PJF1_HUMAN IGG Heavy Chain[220 aa] C 28.6
/74.0
7
/7
SPIKE_CVHSA Spike glycoprotein
2dd8[1] B Q8N355_HUMAN IGG Light Chain[212 aa] C 75.0
/74.0
8
/8
SPIKE_CVHSA Spike glycoprotein
2ghw[2] B Q65ZC9_HUMAN anti-sars scFv antibody, 80R[232 aa] A 37.5
/73.8
24
/24
SPIKE_CVHSA Spike glycoprotein
3bgf[2] F F26G19 Fab[216 aa] B 72.7
/72.5
11
/11
SPIKE_CVHSA Spike protein S1
3bgf[2] C F26G19 Fab[212 aa] A 71.4
/72.6
7
/7
SPIKE_CVHSA Spike protein S1
5yl9[3] B SPIKE_CVH22 Spike glycoprotein[55 aa] A 51.7
/51.4
29
/36
SPIKE_CVH22 Spike glycoprotein
5yl9[3] B SPIKE_CVH22 Spike glycoprotein[55 aa] A 46.2
/51.4
26
/33
SPIKE_CVH22 Spike glycoprotein
6pz8[3] B W6A090_9BETC S protein[513 aa] E 38.2
/47.6
34
/35
W5ZZF5_9BETC S protein
5w9k[20] F G4 VL[111 aa] D 0.0
/47.6
2
/5
W5ZZF5_9BETC Spike glycoprotein
5w9k[24] B G4 VH[119 aa] A 28.6
/47.6
7
/12
W5ZZF5_9BETC Spike glycoprotein
6pz8[3] A W5ZZF5_9BETC S protein[463 aa] J 33.3
/45.5
9
/35
W6A090_9BETC S protein
6nb3[3] D LCA60 heavy chain[123 aa] A 40.0
/37.5
5
/7
A0A140AYW5_9BETC Spike glycoprotein
6nb3[1] C LCA60 heavy chain[124 aa] A 100.0
/37.5
1
/1
A0A140AYW5_9BETC Spike glycoprotein
6nb4[3] E LCA60 light chain[106 aa] A 16.7
/37.5
6
/10
A0A140AYW5_9BETC Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6vyb[6] TA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/99.7
2
/2
spike glycoprotein
6vsj[3] M NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 25.0
/38.4
4
/5
SPIKE_CVMA5 Spike glycoprotein
6cs1[169] AB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 100.0
/76.3
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6nb7[9] T NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/77.8
3
/3
SPIKE_CVHSA Spike glycoprotein
6crv[103] I NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/76.8
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6u7h[3] WA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 0.0
/35.6
1
/1
spike glycoprotein
6vv5[12] U NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 0.0
/37.8
3
/7
S5RJN4_9ALPC Spike glycoprotein
6crx[47] LA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 50.0
/76.3
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6u7k[3] ZA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 0.0
/36.9
1
/3
SPIKE_PEDV7 Spike glycoprotein
6nb7[4] L NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 0.0
/77.8
1
/1
SPIKE_CVHSA Spike glycoprotein
6nb7[12] AD NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/78.1
1
/1
SPIKE_CVHSA Spike glycoprotein
6nb7[3] NA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 0.0
/77.8
1
/1
SPIKE_CVHSA Spike glycoprotein
6cs0[21] BA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 75.0
/76.2
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6nb6[6] LE NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/77.7
1
/1
SPIKE_CVHSA Spike glycoprotein
5w9i[6] KA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
E 50.0
/47.6
2
/2
W5ZZF5_9BETC Spike glycoprotein
6cs0[21] EA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 100.0
/76.2
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6u7k[13] CA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 50.0
/36.9
2
/2
SPIKE_PEDV7 Spike glycoprotein
6cs0[30] E NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/76.3
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6nb6[6] I NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/77.9
2
/2
SPIKE_CVHSA Spike glycoprotein
5szs[6] DH NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/36.0
1
/1
SPIKE_CVHNL Spike glycoprotein
6crz[30] IB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 60.0
/76.3
5
/5
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6vv5[3] SC NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 40.0
/37.8
5
/5
S5RJN4_9ALPC Spike glycoprotein
6nzk[39] AD NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 33.3
/37.6
3
/3
Q696P8_CVHOC Spike surface glycoprotein
6nb6[6] K NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 50.0
/77.9
2
/2
SPIKE_CVHSA Spike glycoprotein
6vv5[6] RA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 0.0
/37.8
1
/1
S5RJN4_9ALPC Spike glycoprotein
6q04[13] WC NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 0.0
/38.0
1
/1
K0BRG7_9BETC Spike glycoprotein
6q04[27] S NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 0.0
/38.0
3
/3
K0BRG7_9BETC Spike glycoprotein
6cs0[24] I NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/76.3
3
/3
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6vsb[92] KA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 100.0
/99.8
4
/4
Spike glycoprotein
6pz8[3] RA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
E 80.0
/47.6
5
/5
W5ZZF5_9BETC S protein
5xgr[12] Q NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
D 0.0
/31.4
1
/1
SPIKE_BCHK5 Spike protein S1
6vv5[18] RC NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 0.0
/37.8
2
/2
S5RJN4_9ALPC Spike glycoprotein
5x58[7] G NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 100.0
/76.5
1
/1
Spike glycoprotein
6jx7[3] NE NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 0.0
/37.2
1
/2
Feline Infectious Peritonitis Virus Spike Protein
6nb7[6] ND NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 50.0
/78.1
4
/4
SPIKE_CVHSA Spike glycoprotein
6vyb[19] E NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/99.7
5
/5
spike glycoprotein
5w9i[12] HB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
I 50.0
/47.6
2
/2
W5ZZF5_9BETC Spike glycoprotein
6nb7[6] TD NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 50.0
/78.1
2
/2
SPIKE_CVHSA Spike glycoprotein
6q04[25] Z NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/38.0
1
/5
K0BRG7_9BETC Spike glycoprotein
6nb7[24] UD NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/78.1
2
/2
SPIKE_CVHSA Spike glycoprotein
6cv0[3] H NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 33.3
/39.1
6
/6
F4MIW6_9GAMC Spike glycoprotein
6crw[15] XA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 75.0
/76.2
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
5x58[27] R NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/76.5
1
/1
Spike glycoprotein
6nb3[15] VA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/37.5
1
/1
A0A140AYW5_9BETC Spike glycoprotein
6b7n[6] N NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/41.9
2
/2
A0A075E3D7_9NIDO Spike protein
6nzk[12] BD NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 33.3
/37.6
3
/3
Q696P8_CVHOC Spike surface glycoprotein
5szs[18] YG NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 66.7
/36.0
3
/3
SPIKE_CVHNL Spike glycoprotein
5szs[3] WG NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 0.0
/36.0
2
/2
SPIKE_CVHNL Spike glycoprotein
5x59[3] DA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/37.4
1
/1
W6A028_9BETC S protein
6vsb[15] XA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/99.8
2
/2
Spike glycoprotein
6cv0[3] PB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 33.3
/39.1
3
/3
F4MIW6_9GAMC Spike glycoprotein
6pz8[3] TB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
I 0.0
/47.6
1
/6
W5ZZF5_9BETC S protein
6vyb[6] HB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/99.7
2
/2
spike glycoprotein
5szs[6] AH NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 0.0
/36.0
2
/3
SPIKE_CVHNL Spike glycoprotein
6q05[21] PD NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/38.0
1
/1
K0BRG7_9BETC Spike glycoprotein
6crx[26] XA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 0.0
/76.2
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6nb6[1] X NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 0.0
/77.9
1
/1
SPIKE_CVHSA Spike glycoprotein
5szs[3] MD NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 50.0
/36.0
2
/2
SPIKE_CVHNL Spike glycoprotein
6nb6[6] S NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/77.9
1
/1
SPIKE_CVHSA Spike glycoprotein
5x59[6] H NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/37.4
2
/2
W6A028_9BETC S protein
6vyb[6] J NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/99.7
4
/4
spike glycoprotein
6nb6[21] W NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/77.9
2
/2
SPIKE_CVHSA Spike glycoprotein
6pz8[3] P NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 33.3
/47.6
3
/3
W5ZZF5_9BETC S protein
5szs[3] SA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 40.0
/36.0
5
/6
SPIKE_CVHNL Spike glycoprotein
6nb6[5] Q NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/77.9
1
/1
SPIKE_CVHSA Spike glycoprotein
6vsb[8] LA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/99.8
1
/1
Spike glycoprotein
5szs[6] LH NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 40.0
/36.0
5
/5
SPIKE_CVHNL Spike glycoprotein
6nzk[7] MB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 25.0
/37.6
4
/4
Q696P8_CVHOC Spike surface glycoprotein
5x58[3] L NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 50.0
/76.5
4
/4
Spike glycoprotein
6nb7[1] RD NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/78.1
1
/1
SPIKE_CVHSA Spike glycoprotein
6vsb[3] DB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/99.8
1
/1
Spike glycoprotein
5w9h[2] LA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
G 0.0
/47.6
2
/4
W5ZZF5_9BETC MERS S
6jx7[3] MB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 0.0
/37.2
1
/1
Feline Infectious Peritonitis Virus Spike Protein
6ohw[9] LC NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 0.0
/37.6
3
/3
Q696P8_CVHOC Spike surface glycoprotein
5w9h[5] GA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
G 0.0
/47.6
1
/1
W5ZZF5_9BETC MERS S
6vyb[6] DA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 100.0
/99.7
1
/1
spike glycoprotein
6u7h[3] XB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/35.6
1
/1
spike glycoprotein
6u7k[3] WA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 0.0
/36.9
1
/1
SPIKE_PEDV7 Spike glycoprotein
6bfu[3] DB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 0.0
/42.3
1
/1
A0A140ES81_9NIDO Spike protein
5xgr[7] AA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
G 100.0
/31.4
1
/1
SPIKE_BCHK5 Spike protein S1
6u7h[3] YA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 33.3
/35.6
3
/3
spike glycoprotein
6u7h[3] XA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 0.0
/35.6
1
/1
spike glycoprotein
6q05[15] BD NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 0.0
/38.0
4
/4
K0BRG7_9BETC Spike glycoprotein
6cv0[3] JB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/39.1
1
/1
F4MIW6_9GAMC Spike glycoprotein
6vsb[3] HB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/99.8
2
/2
Spike glycoprotein
6vxx[3] VA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 100.0
/99.8
2
/2
spike glycoprotein
5szs[3] DA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 100.0
/36.0
1
/1
SPIKE_CVHNL Spike glycoprotein
6nb6[6] AB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/77.9
2
/2
SPIKE_CVHSA Spike glycoprotein
5szs[5] YB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 33.3
/36.0
3
/3
SPIKE_CVHNL Spike glycoprotein
6b7n[3] Q NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 0.0
/41.9
1
/1
A0A075E3D7_9NIDO Spike protein
6cv0[3] LA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/39.1
1
/1
F4MIW6_9GAMC Spike glycoprotein
6vsb[3] P NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/99.8
1
/1
Spike glycoprotein
6crx[1] N NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/76.2
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6bfu[3] MF NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 50.0
/42.3
2
/2
A0A140ES81_9NIDO Spike protein
6nzk[6] YC NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 0.0
/37.6
1
/3
Q696P8_CVHOC Spike surface glycoprotein
6vv5[3] UC NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 33.3
/37.8
3
/3
S5RJN4_9ALPC Spike glycoprotein
6pz8[3] NB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
I 50.0
/47.6
2
/2
W5ZZF5_9BETC S protein
6ohw[9] QA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 0.0
/37.6
1
/1
Q696P8_CVHOC Spike surface glycoprotein
6vsb[2] KB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/99.8
2
/2
Spike glycoprotein
6jx7[3] BE NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 33.3
/37.2
3
/5
Feline Infectious Peritonitis Virus Spike Protein
6vyb[1] AA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/99.7
1
/1
spike glycoprotein
6nb6[3] RB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 0.0
/77.7
1
/1
SPIKE_CVHSA Spike glycoprotein
5szs[3] SE NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 100.0
/36.0
2
/2
SPIKE_CVHNL Spike glycoprotein
6cv0[4] N NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 0.0
/39.1
2
/3
F4MIW6_9GAMC Spike glycoprotein
6vxx[6] NA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 100.0
/99.8
4
/4
spike glycoprotein
6nb7[1] BA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 0.0
/77.8
1
/1
SPIKE_CVHSA Spike glycoprotein
6jx7[3] SG NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/37.2
1
/1
Feline Infectious Peritonitis Virus Spike Protein
5szs[3] YD NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 33.3
/36.0
3
/3
SPIKE_CVHNL Spike glycoprotein
5szs[3] ND NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 66.7
/36.0
3
/3
SPIKE_CVHNL Spike glycoprotein
5x58[7] L NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/76.5
3
/3
Spike glycoprotein
6jx7[3] NG NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/37.2
1
/1
Feline Infectious Peritonitis Virus Spike Protein
6jx7[3] TB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/37.2
1
/1
Feline Infectious Peritonitis Virus Spike Protein
6nzk[3] SA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/37.6
1
/1
Q696P8_CVHOC Spike surface glycoprotein
6u7k[6] T NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/36.9
1
/1
SPIKE_PEDV7 Spike glycoprotein
5szs[3] PG NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 0.0
/36.0
3
/3
SPIKE_CVHNL Spike glycoprotein
5w9h[2] TB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
L 0.0
/28.3
1
/2
W5ZZF5_9BETC MERS S
5w9h[1] EA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/47.6
1
/1
W5ZZF5_9BETC MERS S
5gyq[1] B NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 0.0
/33.0
3
/6
SPIKE_BCHK9 Spike glycoprotein
6u7h[3] WB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/35.6
1
/1
spike glycoprotein
5x59[3] I NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 50.0
/37.4
2
/2
W6A028_9BETC S protein
6vv5[3] JB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 66.7
/37.8
3
/3
S5RJN4_9ALPC Spike glycoprotein
5x58[3] X NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 83.3
/76.5
6
/6
Spike glycoprotein
3d0g[2] M NAG
N-ACETYL-D-GLUCOSAMINE[15 atoms]
C 100.0
/72.3
1
/1
SPIKE_CVHSA Spike glycoprotein
6nb7[5] CC NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/77.8
2
/2
SPIKE_CVHSA Spike glycoprotein
5w9h[2] OB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
K 100.0
/28.3
2
/2
W5ZZF5_9BETC MERS S
6u7k[3] ZB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 0.0
/36.9
1
/1
SPIKE_PEDV7 Spike glycoprotein
6vsb[1] IB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 100.0
/99.8
1
/1
Spike glycoprotein
6nb3[1] PA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
G 100.0
/37.5
1
/1
A0A140AYW5_9BETC Spike glycoprotein
2dd8[2] E NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/74.0
5
/5
SPIKE_CVHSA Spike glycoprotein
5w9h[1] NB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
K 0.0
/28.3
1
/1
W5ZZF5_9BETC MERS S
6u7k[3] WB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 0.0
/36.9
6
/6
SPIKE_PEDV7 Spike glycoprotein
6nb6[1] OD NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 50.0
/77.9
2
/2
SPIKE_CVHSA Spike glycoprotein
3d0h[2] N NDG
2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE[15 atoms..
D 100.0
/72.3
1
/1
SPIKE_CVHSA Spike glycoprotein
6q07[12] LC FOL
FOLIC ACID[32 atoms]
B 100.0
/38.0
2
/13
K0BRG7_9BETC Spike glycoprotein
2ajf[1] O BMA
BETA-D-MANNOSE[11 atoms]
D 100.0
/72.4
1
/1
SPIKE_CVHSA SARS-coronavirus spike protein
6ohw[6] L BMA
BETA-D-MANNOSE[11 atoms]
B 100.0
/37.6
1
/1
Q696P8_CVHOC Spike surface glycoprotein
6jx7[3] NB BMA
BETA-D-MANNOSE[11 atoms]
A 0.0
/37.2
1
/1
Feline Infectious Peritonitis Virus Spike Protein
6q06[12] L BMA
BETA-D-MANNOSE[11 atoms]
C 0.0
/38.0
2
/2
K0BRG7_9BETC Spike glycoprotein
6u7k[3] G BMA
BETA-D-MANNOSE[11 atoms]
C 0.0
/36.9
1
/1
SPIKE_PEDV7 Spike glycoprotein
5szs[3] AD BMA
BETA-D-MANNOSE[11 atoms]
C 50.0
/36.0
2
/2
SPIKE_CVHNL Spike glycoprotein
6vv5[3] WB BMA
BETA-D-MANNOSE[11 atoms]
A 0.0
/37.8
1
/1
S5RJN4_9ALPC Spike glycoprotein
6vw1[1] G BMA
BETA-D-MANNOSE[11 atoms]
C 100.0
/88.1
2
/2
2019-nCoV chimeric RBD
6jx7[6] FH MAN
ALPHA-D-MANNOSE[11 atoms]
C 0.0
/37.2
1
/1
Feline Infectious Peritonitis Virus Spike Protein
6vv5[6] SA MAN
ALPHA-D-MANNOSE[11 atoms]
C 0.0
/37.8
1
/1
S5RJN4_9ALPC Spike glycoprotein
6nb3[1] SA MAN
ALPHA-D-MANNOSE[11 atoms]
G 0.0
/37.5
2
/2
A0A140AYW5_9BETC Spike glycoprotein
6u7k[1] H MAN
ALPHA-D-MANNOSE[11 atoms]
C 0.0
/36.9
1
/1
SPIKE_PEDV7 Spike glycoprotein
6jx7[3] VA MAN
ALPHA-D-MANNOSE[11 atoms]
C 0.0
/37.2
1
/1
Feline Infectious Peritonitis Virus Spike Protein
6vv5[3] XB MAN
ALPHA-D-MANNOSE[11 atoms]
A 0.0
/37.8
1
/1
S5RJN4_9ALPC Spike glycoprotein
5szs[3] ZF MAN
ALPHA-D-MANNOSE[11 atoms]
C 33.3
/36.0
3
/3
SPIKE_CVHNL Spike glycoprotein
6nb4[6] QA MAN
ALPHA-D-MANNOSE[11 atoms]
B 33.3
/45.2
3
/3
A0A140AYW5_9BETC Spike glycoprotein
6q07[12] GB MAN
ALPHA-D-MANNOSE[11 atoms]
A 0.0
/38.0
4
/4
K0BRG7_9BETC Spike glycoprotein
6bfu[3] FD MAN
ALPHA-D-MANNOSE[11 atoms]
B 0.0
/42.3
1
/1
A0A140ES81_9NIDO Spike protein
6u7k[1] I MAN
ALPHA-D-MANNOSE[11 atoms]
C 0.0
/36.9
1
/1
SPIKE_PEDV7 Spike glycoprotein
6nb3[1] UA MAN
ALPHA-D-MANNOSE[11 atoms]
G 0.0
/37.5
1
/1
A0A140AYW5_9BETC Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1zv8[3] Q NA
SODIUM ION[1 atoms]
G 100.0
/82.0
2
/2
VGL2_CVHSA E2 glycoprotein
1zv8[2] M NA
SODIUM ION[1 atoms]
B 100.0
/100.0
1
/1
VGL2_CVHSA E2 glycoprotein
1zv8[1] N NA
SODIUM ION[1 atoms]
B 100.0
/100.0
1
/1
VGL2_CVHSA E2 glycoprotein
1zv8[1] U NA
SODIUM ION[1 atoms]
J 100.0
/100.0
1
/1
VGL2_CVHSA E2 glycoprotein
6lxt[1] L ZN
ZINC ION[1 atoms]
B 100.0
/100.0
1
/1
D5HJT4_BCHK3 SPIKE_BCHK3 2019-nCoV S2 subunit,2019-nCoV S2 subunit
6lxt[2] H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
D5HJT4_BCHK3 SPIKE_BCHK3 2019-nCoV S2 subunit,2019-nCoV S2 subunit
6lxt[1] J ZN
ZINC ION[1 atoms]
A 100.0
/100.0
1
/1
D5HJT4_BCHK3 SPIKE_BCHK3 2019-nCoV S2 subunit,2019-nCoV S2 subunit
1zv8[2] S ZN
ZINC ION[1 atoms]
H 100.0
/100.0
1
/1
VGL2_CVHSA E2 glycoprotein
1zv8[1] P ZN
ZINC ION[1 atoms]
G 100.0
/82.0
1
/1
VGL2_CVHSA E2 glycoprotein
6lxt[1] K ZN
ZINC ION[1 atoms]
B 100.0
/100.0
1
/1
D5HJT4_BCHK3 SPIKE_BCHK3 2019-nCoV S2 subunit,2019-nCoV S2 subunit
6lxt[1] N ZN
ZINC ION[1 atoms]
F 100.0
/100.0
1
/1
D5HJT4_BCHK3 SPIKE_BCHK3 2019-nCoV S2 subunit,2019-nCoV S2 subunit
1wyy[18] F CL
CHLORIDE ION[1 atoms]
B 100.0
/92.7
1
/1
SPIKE_CVHSA E2 Glycoprotein
1zv7[4] C CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
1
/1
SPIKE_CVHSA spike glycoprotein
2ghw[1] F CL
CHLORIDE ION[1 atoms]
A 100.0
/73.8
1
/1
SPIKE_CVHSA Spike glycoprotein
5zuv[1] E CL
CHLORIDE ION[1 atoms]
B 100.0
/47.3
1
/1
SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK..
2ghw[3] I CL
CHLORIDE ION[1 atoms]
C 100.0
/73.4
1
/1
SPIKE_CVHSA Spike glycoprotein
2ghw[1] H CL
CHLORIDE ION[1 atoms]
A 100.0
/73.8
1
/1
SPIKE_CVHSA Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1zvb[6] C SPIKE_CVHSA E2 glycoprotein[34 aa] B 100.0
/100.0
11
/11
SPIKE_CVHSA E2 glycoprotein
1zva[2] A VGL2_CVHSA VGL2_CVHSA E2 glycoprotein[75 aa] A 100.0
/100.0
30
/31
VGL2_CVHSA VGL2_CVHSA E2 glycoprotein
6lxt[6] E D5HJT4_BCHK3 SPIKE_BCHK3 2019-nCoV S2 subunit,2019-nCoV S2 subunit[114 aa] D 100.0
/100.0
42
/42
D5HJT4_BCHK3 SPIKE_BCHK3 2019-nCoV S2 subunit,2019-nCoV S2 subunit
6lxt[6] C D5HJT4_BCHK3 SPIKE_BCHK3 2019-nCoV S2 subunit,2019-nCoV S2 subunit[117 aa] A 100.0
/100.0
34
/34
D5HJT4_BCHK3 SPIKE_BCHK3 2019-nCoV S2 subunit,2019-nCoV S2 subunit
6lvn[52] C 2019-nCoV S2 subunit[33 aa] B 100.0
/100.0
4
/4
2019-nCoV S2 subunit
2beq[2] E VGL2_CVHSA E2 GLYCOPROTEIN[47 aa] D 100.0
/100.0
1
/1
VGL2_CVHSA E2 GLYCOPROTEIN
6vxx[6] A spike glycoprotein[972 aa] C 98.9
/99.8
94
/94
spike glycoprotein
6vyb[6] C spike glycoprotein[960 aa] A 100.0
/99.7
81
/81
spike glycoprotein
6vsb[3] A Spike glycoprotein[959 aa] B 100.0
/99.8
73
/73
Spike glycoprotein
6vsb[3] C Spike glycoprotein[973 aa] B 98.9
/99.8
88
/88
Spike glycoprotein
1wyy[12] A SPIKE_CVHSA E2 Glycoprotein[126 aa] A 85.4
/92.9
41
/41
SPIKE_CVHSA E2 Glycoprotein
1wnc[8] F VGL2_CVHSA E2 glycoprotein[75 aa] B 100.0
/87.7
8
/8
VGL2_CVHSA E2 glycoprotein
1wnc[6] D VGL2_CVHSA E2 glycoprotein[77 aa] F 78.9
/86.7
19
/19
VGL2_CVHSA E2 glycoprotein
2bez[6] A VGL2_CVHSA E2 GLYCOPROTEIN[77 aa] A 100.0
/88.3
16
/16
VGL2_CVHSA E2 GLYCOPROTEIN
5zvm[6] C SPIKE_CVHSA Spike glycoprotein[67 aa] B 100.0
/88.2
17
/17
SPIKE_CVHSA Spike glycoprotein
5wrg[3] B SPIKE_CVHSA Spike glycoprotein[736 aa] A 85.1
/81.9
47
/47
SPIKE_CVHSA Spike glycoprotein
5wrg[3] C SPIKE_CVHSA Spike glycoprotein[736 aa] A 93.6
/81.9
47
/47
SPIKE_CVHSA Spike glycoprotein
1zv8[12] G VGL2_CVHSA E2 glycoprotein[50 aa] I 100.0
/81.6
10
/10
VGL2_CVHSA E2 glycoprotein
2beq[12] A VGL2_CVHSA E2 GLYCOPROTEIN[37 aa] B 100.0
/80.6
5
/5
VGL2_CVHSA E2 GLYCOPROTEIN
6cs2[1] C SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[893 aa] B 83.3
/76.3
72
/72
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[1] C SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[893 aa] A 91.9
/77.1
62
/62
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[1] A SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[891 aa] B 90.6
/76.3
64
/64
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[1] A SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[891 aa] C 85.5
/77.0
69
/69
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6crv[3] C SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[881 aa] B 84.8
/76.8
79
/79
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6crv[3] A SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[881 aa] B 90.0
/76.8
70
/70
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
5x5b[22] A Spike glycoprotein[1033 aa] B 91.9
/76.5
74
/74
Spike glycoprotein
6acc[18] B SPIKE_CVHSA Spike glycoprotein[1065 aa] C 86.5
/76.7
96
/96
SPIKE_CVHSA Spike glycoprotein
6ack[18] A SPIKE_CVHSA Spike glycoprotein[1065 aa] C 89.5
/76.7
86
/86
SPIKE_CVHSA Spike glycoprotein
6nb6[6] C SPIKE_CVHSA Spike glycoprotein[1055 aa] A 93.0
/77.9
71
/71
SPIKE_CVHSA Spike glycoprotein
5x5b[22] C Spike glycoprotein[1053 aa] B 88.5
/76.5
96
/96
Spike glycoprotein
6nb7[6] B SPIKE_CVHSA Spike glycoprotein[1032 aa] A 88.5
/77.8
52
/52
SPIKE_CVHSA Spike glycoprotein
2ghv[2] A SPIKE_CVHSA Spike glycoprotein[183 aa] B 83.3
/73.2
18
/18
SPIKE_CVHSA Spike glycoprotein
1wdg[3] B VGL2_CVMA5 E2 glycoprotein[74 aa] A 0.0
/62.5
1
/4
VGL2_CVMA5 E2 glycoprotein
1wdg[6] B VGL2_CVMA5 E2 glycoprotein[74 aa] B 63.6
/62.5
22
/22
VGL2_CVMA5 E2 glycoprotein
1wdg[3] A VGL2_CVMA5 E2 glycoprotein[81 aa] A 87.5
/62.5
8
/26
VGL2_CVMA5 E2 glycoprotein
1wdg[3] A VGL2_CVMA5 E2 glycoprotein[81 aa] A 59.1
/62.5
22
/25
VGL2_CVMA5 E2 glycoprotein
1wdf[3] A VGL2_CVMA5 E2 glycoprotein[91 aa] A 81.8
/60.7
11
/32
VGL2_CVMA5 E2 glycoprotein
1wdf[3] A VGL2_CVMA5 E2 glycoprotein[91 aa] B 0.0
/63.0
1
/5
VGL2_CVMA5 E2 glycoprotein
1wdf[3] A VGL2_CVMA5 E2 glycoprotein[91 aa] A 64.3
/60.7
28
/28
VGL2_CVMA5 E2 glycoprotein
1wdf[3] B VGL2_CVMA5 E2 glycoprotein[93 aa] A 100.0
/60.7
1
/5
VGL2_CVMA5 E2 glycoprotein
1wdf[3] B VGL2_CVMA5 E2 glycoprotein[93 aa] A 66.7
/60.7
3
/3
VGL2_CVMA5 E2 glycoprotein
5zvk[6] C W6A0A7_9BETC Human Coronavirus MERS HR1 motif[70 aa] A 64.7
/55.7
17
/17
W6A0A7_9BETC Human Coronavirus MERS HR1 motif
4mod[6] B K0BRG7_9BETC K0BRG7_9BETC HR1 of S protein, LINKER, HR2 of S protein[76 aa] B 50.0
/53.2
12
/29
K0BRG7_9BETC K0BRG7_9BETC HR1 of S protein, LINKER, HR2 of S protein
4mod[6] B K0BRG7_9BETC K0BRG7_9BETC HR1 of S protein, LINKER, HR2 of S protein[76 aa] B 46.2
/53.2
26
/26
K0BRG7_9BETC K0BRG7_9BETC HR1 of S protein, LINKER, HR2 of S protein
5yl9[6] A SPIKE_CVH22 Spike glycoprotein[88 aa] A 54.2
/51.4
24
/28
SPIKE_CVH22 Spike glycoprotein
4njl[6] A R9UQ53_9BETC S protein[129 aa] A 60.0
/50.8
45
/48
R9UQ53_9BETC S protein
5zuv[2] B SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK.. C 61.8
/50.5
34
/42
SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK..
5zuv[2] B SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK.. A 51.2
/47.3
41
/46
SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK..
5w9h[27] A W5ZZF5_9BETC MERS S[463 aa] L 27.0
/28.3
37
/39
W5ZZF5_9BETC MERS S
5w9k[21] A W5ZZF5_9BETC Spike glycoprotein[461 aa] J 33.3
/28.3
15
/22
W5ZZF5_9BETC Spike glycoprotein
5w9k[27] D W5ZZF5_9BETC Spike glycoprotein[462 aa] A 26.7
/47.6
15
/28
W5ZZF5_9BETC Spike glycoprotein
5w9p[27] I W5ZZF5_9BETC Spike glycoprotein[463 aa] E 44.0
/47.6
25
/25
W5ZZF5_9BETC Spike glycoprotein
6pz8[3] I W5ZZF5_9BETC S protein[463 aa] A 36.7
/47.6
30
/30
W5ZZF5_9BETC S protein
6pz8[3] E W5ZZF5_9BETC S protein[463 aa] A 18.8
/47.6
16
/32
W5ZZF5_9BETC S protein
5w9p[6] J W5ZZF5_9BETC Spike glycoprotein[513 aa] F 25.0
/45.5
4
/12
W5ZZF5_9BETC Spike glycoprotein
5w9i[6] B W5ZZF5_9BETC Spike glycoprotein[513 aa] I 30.0
/47.6
30
/31
W5ZZF5_9BETC Spike glycoprotein
5zuv[1] C SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK.. A 62.5
/47.3
32
/40
SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK..
5zuv[1] C SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK.. B 53.8
/47.3
39
/43
SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK..
6pz8[3] B W6A090_9BETC S protein[513 aa] F 25.0
/45.5
4
/14
W6A090_9BETC S protein
6b3o[6] C SPIKE_CVMA5 Spike glycoprotein[344 aa] A 50.8
/43.2
118
/118
SPIKE_CVMA5 Spike glycoprotein
6b7n[3] B A0A075E3D7_9NIDO Spike protein[966 aa] A 17.4
/41.9
23
/97
A0A075E3D7_9NIDO Spike protein
6b7n[3] A A0A075E3D7_9NIDO Spike protein[966 aa] B 28.2
/41.9
78
/105
A0A075E3D7_9NIDO Spike protein
6bfu[3] B A0A140ES81_9NIDO Spike protein[964 aa] A 28.2
/42.3
85
/113
A0A140ES81_9NIDO Spike protein
6bfu[3] B A0A140ES81_9NIDO Spike protein[964 aa] C 18.5
/42.3
27
/117
A0A140ES81_9NIDO Spike protein
5i08[3] B SPIKE_CVHN5 M1E1E4_9HIV1 Spike glycoprotein, envelope glycoprotein chimera[.. C 40.0
/39.5
55
/75
SPIKE_CVHN5 M1E1E4_9HIV1 Spike glycoprotein, envelope glycoprotein chimera
5i08[3] A SPIKE_CVHN5 M1E1E4_9HIV1 Spike glycoprotein, envelope glycoprotein chimera[.. C 29.1
/39.5
55
/63
SPIKE_CVHN5 M1E1E4_9HIV1 Spike glycoprotein, envelope glycoprotein chimera
6cv0[3] C F4MIW6_9GAMC Spike glycoprotein[993 aa] B 16.7
/39.1
24
/106
F4MIW6_9GAMC Spike glycoprotein
6cv0[3] A F4MIW6_9GAMC Spike glycoprotein[993 aa] B 27.1
/39.1
70
/107
F4MIW6_9GAMC Spike glycoprotein
6vsj[3] C SPIKE_CVMA5 Spike glycoprotein[1122 aa] E 31.1
/38.4
74
/94
SPIKE_CVMA5 Spike glycoprotein
6vsj[3] C SPIKE_CVMA5 Spike glycoprotein[1122 aa] A 37.3
/38.4
67
/92
SPIKE_CVMA5 Spike glycoprotein
3jcl[3] C SPIKE_CVMA5 Spike glycoprotein[1067 aa] A 25.5
/39.0
55
/60
SPIKE_CVMA5 Spike glycoprotein
3jcl[3] C SPIKE_CVMA5 Spike glycoprotein[1067 aa] B 37.3
/39.0
51
/57
SPIKE_CVMA5 Spike glycoprotein
6vv5[3] B S5RJN4_9ALPC Spike glycoprotein[1098 aa] C 26.8
/37.8
71
/97
S5RJN4_9ALPC Spike glycoprotein
6vv5[3] C S5RJN4_9ALPC Spike glycoprotein[1098 aa] B 36.5
/37.8
63
/101
S5RJN4_9ALPC Spike glycoprotein
6ohw[6] A Q696P8_CVHOC Spike surface glycoprotein[1175 aa] B 35.1
/37.6
94
/117
Q696P8_CVHOC Spike surface glycoprotein
6ohw[6] C Q696P8_CVHOC Spike surface glycoprotein[1175 aa] B 26.1
/37.6
92
/107
Q696P8_CVHOC Spike surface glycoprotein
6nb4[1] C A0A140AYW5_9BETC Spike glycoprotein[959 aa] B 27.5
/45.2
40
/73
A0A140AYW5_9BETC Spike glycoprotein
6nb4[1] C A0A140AYW5_9BETC Spike glycoprotein[959 aa] A 32.9
/37.5
70
/79
A0A140AYW5_9BETC Spike glycoprotein
6nb3[2] F A0A140AYW5_9BETC Spike glycoprotein[958 aa] A 25.9
/37.5
81
/94
A0A140AYW5_9BETC Spike glycoprotein
6nb4[2] B A0A140AYW5_9BETC Spike glycoprotein[958 aa] C 35.4
/45.2
65
/76
A0A140AYW5_9BETC Spike glycoprotein
5x5f[9] C W6A028_9BETC S protein[1141 aa] B 32.2
/37.4
87
/100
W6A028_9BETC S protein
6q05[15] B K0BRG7_9BETC Spike glycoprotein[1159 aa] C 37.2
/38.0
86
/110
K0BRG7_9BETC Spike glycoprotein
5x5c[9] A W6A028_9BETC S protein[1141 aa] B 32.8
/37.4
67
/77
W6A028_9BETC S protein
6nb4[15] A A0A140AYW5_9BETC Spike glycoprotein[1169 aa] C 27.1
/45.2
48
/77
A0A140AYW5_9BETC Spike glycoprotein
6jx7[3] B Feline Infectious Peritonitis Virus Spike Protein[.. A 30.0
/37.2
70
/111
Feline Infectious Peritonitis Virus Spike Protein
6jx7[3] B Feline Infectious Peritonitis Virus Spike Protein[.. C 19.7
/37.2
66
/107
Feline Infectious Peritonitis Virus Spike Protein
6u7k[3] C SPIKE_PEDV7 Spike glycoprotein[1064 aa] B 33.8
/36.9
77
/104
SPIKE_PEDV7 Spike glycoprotein
6u7k[3] A SPIKE_PEDV7 Spike glycoprotein[1064 aa] B 36.1
/36.9
61
/99
SPIKE_PEDV7 Spike glycoprotein
5szs[3] B SPIKE_CVHNL Spike glycoprotein[1177 aa] C 25.4
/36.0
67
/86
SPIKE_CVHNL Spike glycoprotein
5szs[3] A SPIKE_CVHNL Spike glycoprotein[1177 aa] C 25.0
/36.0
68
/81
SPIKE_CVHNL Spike glycoprotein
6u7h[3] A spike glycoprotein[965 aa] C 20.8
/35.6
53
/77
spike glycoprotein
6u7h[3] A spike glycoprotein[965 aa] B 31.5
/35.6
54
/76
spike glycoprotein
5w9l[21] H W5ZZF5_9BETC Spike glycoprotein[726 aa] B 30.4
/47.6
23
/24
W5ZZF5_9BETC Spike glycoprotein
5w9n[21] H W5ZZF5_9BETC MERS S[726 aa] I 25.0
/28.3
4
/11
W5ZZF5_9BETC MERS S
5w9k[21] K W5ZZF5_9BETC Spike glycoprotein[724 aa] J 25.0
/28.3
8
/8
W5ZZF5_9BETC Spike glycoprotein
5w9j[3] J W5ZZF5_9BETC Spike glycoprotein[726 aa] A 100.0
/47.6
1
/12
W5ZZF5_9BETC Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6lxt[2] G PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 100.0
/100.0
1
/1
D5HJT4_BCHK3 SPIKE_BCHK3 2019-nCoV S2 subunit,2019-nCoV S2 subunit
1zv8[1] R ACT
ACETATE ION[4 atoms]
G 100.0
/82.0
1
/1
VGL2_CVHSA E2 glycoprotein
1zv8[1] R ACT
ACETATE ION[4 atoms]
H 100.0
/100.0
2
/2
VGL2_CVHSA E2 glycoprotein
2bez[3] C GOL
GLYCEROL[6 atoms]
A 100.0
/88.3
4
/4
VGL2_CVHSA E2 GLYCOPROTEIN
1zv8[1] O CAC
CACODYLATE ION[5 atoms]
H 100.0
/100.0
1
/1
VGL2_CVHSA E2 glycoprotein
1zv8[1] O CAC
CACODYLATE ION[5 atoms]
G 100.0
/82.0
1
/1
VGL2_CVHSA E2 glycoprotein
4njl[3] B PGE
TRIETHYLENE GLYCOL[10 atoms]
A 0.0
/50.8
2
/2
R9UQ53_9BETC S protein
4njl[3] B PGE
TRIETHYLENE GLYCOL[10 atoms]
A 0.0
/50.8
3
/3
R9UQ53_9BETC S protein
6vv5[3] JA PAM
PALMITOLEIC ACID[18 atoms]
C 0.0
/37.8
2
/2
S5RJN4_9ALPC Spike glycoprotein
6vv5[2] KA PAM
PALMITOLEIC ACID[18 atoms]
A 40.0
/37.8
5
/7
S5RJN4_9ALPC Spike glycoprotein
6vv5[2] SB PAM
PALMITOLEIC ACID[18 atoms]
C 57.1
/37.8
7
/7
S5RJN4_9ALPC Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.