[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
48529 222 0 P0DTC5(VME1_WCPV) RecName: Full=Membrane protein {ECO:0000255|HAMAP-Rule:MF_04202}; Short=M protein {ECO:0000255|HAMAP-Rule:MF_04202};AltName: Full=E1 glycoprotein {ECO:0000255|HAMAP-Rule:MF_04202};AltName: Full=Matrix glycoprotein {ECO:0000255|HAMAP-Rule:MF_04202};AltName: Full=Membrane glycoprotein {ECO:0000255|HAMAP-Rule:MF_04202};
QUERYSEQ
MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLR
IAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTC5(VME1_WCPV)]

222
region name description
1-222 CHAIN /note="Membrane protein" /id="PRO_0000449652"
2-19 TOPO_DOM /note="Virion surface"
20-40 TRANSMEM /note="Helical"
41-50 TOPO_DOM /note="Intravirion"
51-71 TRANSMEM /note="Helical"
72-79 TOPO_DOM /note="Virion surface"
80-100 TRANSMEM /note="Helical"
101-222 TOPO_DOM /note="Intravirion"
1-219 DISORDER predicted by DISOPRED (1-8,212-214,216-219)

No homologue is found in PDB.

Please check [SiteTable] for homologues.