[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57668 121 3 P0DTC7(NS7A_SARS2) RecName: Full=ORF7a protein;AltName: Full=Accessory protein 7a;AltName: Full=Protein U122;AltName: Full=Protein X4;Flags: Precursor;
QUERYSEQ
MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTC7(NS7A_SARS2)]

121
region name description
1-15 SIGNAL
16-121 CHAIN /note="ORF7a protein" /id="PRO_0000449654"
96-116 TRANSMEM /note="Helical"
16-81 DOMAIN /note="X4e"
1-121 DISORDER predicted by DISOPRED (1-10,121-121)

MONOMER
121
pdb_id a1 identity[%]2 description
1yo4 A 91.6 YX4_CVHSA Hypothetical protein X4
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.