[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
35121 121 0 P0DTC8(NS8_SARS2) RecName: Full=Non-structural protein 8; Short=ns8;Flags: Precursor;
QUERYSEQ
MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTC8(NS8_SARS2)]

121
region name description
1-15 SIGNAL
16-121 CHAIN /note="Non-structural protein 8" /id="PRO_0000449655"
1-9 DISORDER predicted by DISOPRED (1-9)

No homologue is found in PDB.

Please check [SiteTable] for homologues.