[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
36236 7096 572 P0DTD1(R1AB_SARS2) RecName: Full=Replicase polyprotein 1ab; Short=pp1ab;AltName: Full=ORF1ab polyprotein;Contains: RecName: Full=Host translation inhibitor nsp1; Short=nsp1; AltName: Full=Leader protein;Contains: RecName: Full=Non-structural protein 2; Short=nsp2; AltName: Full=p65 homolog;Contains: RecName: Full=Non-structural protein 3; Short=nsp3; EC=3.4.19.12; EC=3.4.22.-; AltName: Full=PL2-PRO; AltName: Full=Papain-like proteinase; Short=PL-PRO;Contains: RecName: Full=Non-structural protein 4; Short=nsp4;Contains: RecName: Full=3C-like proteinase; Short=3CL-PRO; Short=3CLp; EC=3.4.22.69 {ECO:0000269|PubMed:32198291}; AltName: Full=SARS coronavirus main proteinase; AltName: Full=nsp5;Contains: RecName: Full=Non-structural protein 6; Short=nsp6;Contains: RecName: Full=Non-structural protein 7; Short=nsp7;Contains: RecName: Full=Non-structural protein 8; Short=nsp8;Contains: RecName: Full=Non-structural protein 9; Short=nsp9;Contains: RecName: Full=Non-structural protein 10; Short=nsp10; AltName: Full=Growth factor-like peptide; Short=GFL;Contains: RecName: Full=RNA-directed RNA polymerase; Short=Pol; Short=RdRp; EC=2.7.7.48; AltName: Full=nsp12;Contains: RecName: Full=Helicase; Short=Hel; EC=3.6.4.12; EC=3.6.4.13; AltName: Full=nsp13;Contains: RecName: Full=Proofreading exoribonuclease; Short=ExoN; EC=3.1.13.-; AltName: Full=Guanine-N7 methyltransferase; AltName: Full=Non-structural protein 14; Short=nsp14;Contains: RecName: Full=Uridylate-specific endoribonuclease; EC=3.1.-.-; AltName: Full=NendoU; AltName: Full=nsp15;Contains: RecName: Full=2'-O-methyltransferase; EC=2.1.1.-; AltName: Full=nsp16;
QUERYSEQ
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELG
TDPYEDFQENWNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI
RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNL
LEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY
ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTE
VLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW
SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAK
KVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE
QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK
SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH
FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSAL
NHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ
ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKP
ASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV
DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAAL
GVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV
VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCE
ESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN
AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKA
CPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST
SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICIST
KHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY
CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVD
RQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW
SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTT
VMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL
AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIIN
NARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD
GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYV
QIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDG
DMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVD
TDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQ
TVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVA
GVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALL
STDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIER
FVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHK
PPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFV
LTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEI
SMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKIL
GLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFIT
REEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYA
CWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSD
KFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR
LQSLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSV
KGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLL
LDDFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLQSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLND
FVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPL
KLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTD1(R1AB_SARS2)]

7096
region name description
1-7096 CHAIN /note="Replicase polyprotein 1ab" /id="PRO_0000449618"
1-180 CHAIN /note="Host translation inhibitor nsp1" /id="PRO_0000449619"
181-818 CHAIN /note="Non-structural protein 2" /id="PRO_0000449620"
819-2763 CHAIN /note="Non-structural protein 3" /id="PRO_0000449621"
2764-3263 CHAIN /note="Non-structural protein 4" /id="PRO_0000449622"
3264-3569 CHAIN /note="3C-like proteinase" /id="PRO_0000449623"
3570-3859 CHAIN /note="Non-structural protein 6" /id="PRO_0000449624"
3860-3942 CHAIN /note="Non-structural protein 7" /id="PRO_0000449625"
3943-4140 CHAIN /note="Non-structural protein 8" /id="PRO_0000449626"
4141-4253 CHAIN /note="Non-structural protein 9" /id="PRO_0000449627"
4254-4392 CHAIN /note="Non-structural protein 10" /id="PRO_0000449628"
4393-5324 CHAIN /note="RNA-directed RNA polymerase" /id="PRO_0000449629"
5325-5925 CHAIN /note="Helicase" /id="PRO_0000449630"
5926-6452 CHAIN /note="Proofreading exoribonuclease" /id="PRO_0000449631"
6453-6798 CHAIN /note="Uridylate-specific endoribonuclease" /id="PRO_0000449632"
6799-7096 CHAIN /note="2'-O-methyltransferase" /id="PRO_0000449633"
1-2225 TOPO_DOM /note="Cytoplasmic"
2226-2246 TRANSMEM /note="Helical"
2247-2317 TOPO_DOM /note="Lumenal"
2318-2338 TRANSMEM /note="Helical"
2339-2775 TOPO_DOM /note="Cytoplasmic"
2776-2796 TRANSMEM /note="Helical"
2797-3044 TOPO_DOM /note="Lumenal"
3045-3065 TRANSMEM /note="Helical"
3066-3099 TOPO_DOM /note="Cytoplasmic"
3100-3120 TRANSMEM /note="Helical"
3121-3127 TOPO_DOM /note="Lumenal"
3128-3148 TRANSMEM /note="Helical"
3149-3586 TOPO_DOM /note="Cytoplasmic"
3587-3607 TRANSMEM /note="Helical"
3608-3608 TOPO_DOM /note="Lumenal"
3609-3629 TRANSMEM /note="Helical"
3630-3634 TOPO_DOM /note="Cytoplasmic"
3635-3655 TRANSMEM /note="Helical"
3656-3673 TOPO_DOM /note="Lumenal"
3674-3694 TRANSMEM /note="Helical"
3695-3729 TOPO_DOM /note="Cytoplasmic"
3730-3750 TRANSMEM /note="Helical"
3751-3778 TOPO_DOM /note="Lumenal"
3779-3799 TRANSMEM /note="Helical"
3800-7096 TOPO_DOM /note="Cytoplasmic"
545-569 REPEAT /note="LRR 1"
697-719 REPEAT /note="LRR 2"
1025-1194 DOMAIN /note="Macro"
1634-1898 DOMAIN /note="Peptidase C16"
1680-1702 REPEAT /note="LRR 3"
3185-3206 REPEAT /note="LRR 4"
3264-3569 DOMAIN /note="Peptidase C30"
3935-3959 REPEAT /note="LRR 5"
3977-4004 REPEAT /note="LRR 6"
4591-4616 REPEAT /note="LRR 7"
5004-5166 DOMAIN /note="RdRp catalytic"
5325-5408 DOMAIN /note="CV ZBD"
5552-5572 REPEAT /note="LRR 8"
5581-5762 DOMAIN /note="(+)RNA virus helicase ATP-binding"
5763-5932 DOMAIN /note="(+)RNA virus helicase C-terminal"
6817-6841 REPEAT /note="LRR 9"
1752-1789 ZN_FING /note="C4-type"
5606-5613 NP_BIND /note="NTP"
1674-1674 ACT_SITE /note="For PL1-PRO activity"
1835-1835 ACT_SITE /note="For PL2-PRO activity"
3304-3304 ACT_SITE /note="For 3CL-PRO activity" ECO:0000305|PubMed:32198291"
3408-3408 ACT_SITE /note="Nucleophile; for 3CL-PRO activity" ECO:0000269|PubMed:32198291"
5329-5329 METAL /note="Zinc 1"
5332-5332 METAL /note="Zinc 1"
5340-5340 METAL /note="Zinc 2"
5343-5343 METAL /note="Zinc 1"
5350-5350 METAL /note="Zinc 1"
5353-5353 METAL /note="Zinc 2; via tele nitrogen"
5357-5357 METAL /note="Zinc 2; via pros nitrogen"
5363-5363 METAL /note="Zinc 2"
5374-5374 METAL /note="Zinc 3"
5379-5379 METAL /note="Zinc 3; via pros nitrogen"
5396-5396 METAL /note="Zinc 3"
5399-5399 METAL /note="Zinc 3"
1-7096 DISORDER predicted by DISOPRED (1-21,23-23,30-30,41-43,746-774,882-883,918-1028,1192-1245,1263-1289,1296-1324,1329-1332,1335-1352,1377-1378,1388-1388,1400-1402,1404-1404,1486-1486,1491-1492,1606-1622,2026-2058,2419-2421,2544-2546,2549-2558,2561-2562,2564-2565,2567-2579,2597-2613,2615-2619,2622-2622,2639-2651,2948-2949,3256-3276,3349-3354,3450-3460,3512-3514,3543-3544,3546-3546,3549-3551,3556-3576,3855-3861,3863-3865,3938-3941,3960-4029,4032-4037,4039-4040,4046-4049,4105-4119,4136-4167,4255-4259,4261-4263,4307-4320,4386-4404,4406-4406,4409-4411,4446-4456,4469-4481,4816-4817,4820-4820,4881-4917,4940-4944,4947-4949,4966-4966,5068-5071,5073-5077,5102-5142,5188-5203,5284-5319,5322-5325,5458-5474,5559-5568,5571-5571,5573-5583,5587-5590,5645-5645,5647-5675,5733-5753,5791-5817,5819-5823,5915-5969,6060-6060,6380-6381,6387-6387,6603-6603,6607-6607,6654-6674,6711-6713,6715-6718,6934-6945,7073-7075,7078-7096)

MONOMER
7096
pdb_id a1 identity[%]2 description
7c2k A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
6xez E 100.0 R1AB_SARS2 nsp13
5c8u D 94.9 R1AB_CVHSA Guanine-N7 methyltransferase
6x1b B 100.0 R1AB_SARS2 Uridylate-specific endoribonuclease
6wuu B 98.8 R1AB_SARS2 papain-like protease
6wtm A 100.0 R1AB_SARS2 3C-like proteinase
6wks A 100.0 R1AB_SARS2 2'-O-methyltransferase
2w2g A 76.3 R1A_CVHSA NON-STRUCTURAL PROTEIN 3
2ahm H 97.4 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
6wey A 100.0 R1AB_SARS2 Non-structural protein 3
6zok U 100.0 R1AB_SARS2 Non-structural protein 1
6m71 B 100.0 R1AB_SARS2 SARS-Cov-2 NSP 7
6wkq D 100.0 R1AB_SARS2 SARS-CoV-2 NSP10
6w4b A 100.0 R1AB_SARS2 Non-structural protein 9
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xfn[4] B UAW243[4 aa] A 100.0
/100.0
14
/14
R1AB_SARS2 main protease
7c2i[17] A R1AB_SARS2 Replicase polyprotein 1ab[298 aa] B 100.0
/100.0
20
/20
R1AB_SARS2 Replicase polyprotein 1ab
6yz1[1] A R1AB_SARS2 nsp16[297 aa] B 100.0
/100.0
18
/18
R1AB_SARS2 nsp10
5nfy[4] H Q1T6X8_CVHSA Polyprotein 1ab[133 aa] C 98.1
/94.7
52
/52
Q1T6X8_CVHSA Polyprotein 1ab
6wkq[21] B R1AB_SARS2 SARS-CoV-2 NSP10[122 aa] A 100.0
/100.0
23
/23
R1AB_SARS2 SARS-CoV-2 NSP16
5c8u[6] A R1AB_CVHSA Non-structural protein 10[133 aa] B 97.9
/94.9
48
/48
R1AB_CVHSA Guanine-N7 methyltransferase
3r24[1] B R1A_CVHSA Non-structural protein 10 and Non-structural prote.. A 100.0
/93.5
21
/21
R1AB_CVHSA 2'-O-methyl transferase
6zlw[1] DA RS30_HUMAN 40S ribosomal protein S30[52 aa] JA 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 1
7bv1[1] D R1AB_SARS2 nsp8[99 aa] C 100.0
/100.0
16
/16
R1AB_SARS2 nsp7
7bv1[1] D R1AB_SARS2 nsp8[99 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 nsp12
6m71[1] C R1AB_SARS2 SARS-Cov-2 NSP 8[43 aa] B 100.0
/100.0
20
/20
R1AB_SARS2 SARS-Cov-2 NSP 7
6m71[1] C R1AB_SARS2 SARS-Cov-2 NSP 8[43 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 SARS-Cov-2 NSP 12
7c2k[11] B R1AB_SARS2 Non-structural protein 8[117 aa] A 100.0
/100.0
48
/48
R1AB_SARS2 RNA-directed RNA polymerase
7bw4[1] B R1AB_SARS2 nsp8[115 aa] A 100.0
/100.0
42
/42
R1AB_SARS2 nsp12
6wtc[13] D R1AB_SARS2 SARS-CoV-2 NSP8[116 aa] C 100.0
/98.6
27
/27
R1AB_SARS2 SARS-CoV-2 NSP7
6wtc[8] B R1AB_SARS2 SARS-CoV-2 NSP8[116 aa] C 100.0
/98.6
10
/10
R1AB_SARS2 SARS-CoV-2 NSP7
7bv2[9] B R1AB_SARS2 nsp8[114 aa] C 100.0
/100.0
3
/3
R1AB_SARS2 nsp7
7bzf[2] D R1AB_SARS2 Non-structural protein 8[104 aa] A 100.0
/100.0
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
6nur[1] D R1A_CVHSA NSP8[109 aa] A 100.0
/97.0
2
/2
R1AB_CVHSA NSP12
6xez[1] D R1AB_SARS2 nsp8[186 aa] A 100.0
/100.0
12
/12
R1AB_SARS2 nsp12
7c2k[2] D R1AB_SARS2 Non-structural protein 8[139 aa] A 100.0
/100.0
13
/13
R1AB_SARS2 RNA-directed RNA polymerase
6xez[1] B R1AB_SARS2 nsp8[186 aa] F 100.0
/100.0
10
/10
R1AB_SARS2 nsp13
6xez[1] D R1AB_SARS2 nsp8[186 aa] E 100.0
/100.0
4
/4
R1AB_SARS2 nsp13
7bv2[10] A R1AB_SARS2 nsp12[834 aa] B 100.0
/100.0
40
/40
R1AB_SARS2 nsp8
7c2k[10] A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] C 94.7
/98.6
19
/19
R1AB_SARS2 Non-structural protein 7
7btf[4] A R1AB_SARS2 NSP12[915 aa] D 100.0
/100.0
1
/1
R1AB_SARS2 NSP8
6xez[1] A R1AB_SARS2 nsp12[926 aa] D 100.0
/100.0
11
/11
R1AB_SARS2 nsp8
7bv1[2] A R1AB_SARS2 nsp12[836 aa] D 100.0
/100.0
2
/2
R1AB_SARS2 nsp8
6yyt[2] A R1AB_SARS2 nsp12[853 aa] D 100.0
/100.0
10
/10
R1AB_SARS2 nsp8
6xbh[2] B inhibitor UAW247[3 aa] A 100.0
/100.0
17
/17
R1AB_SARS2 main protease
7bw4[1] D R1AB_SARS2 nsp8[87 aa] C 100.0
/100.0
15
/15
R1AB_SARS2 nsp7
6xqb[1] D R1AB_SARS2 Non-structural protein 8[31 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
6xqb[1] D R1AB_SARS2 Non-structural protein 8[31 aa] C 100.0
/100.0
12
/12
R1AB_SARS2 Non-structural protein 7
6xch[6] B Leupeptin[4 aa] A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
6zp4[7] T RS3_HUMAN 40S ribosomal protein S3[224 aa] BB 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 1
6zlw[8] C RS2_HUMAN 40S ribosomal protein S2[218 aa] JA 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 1
6xbi[2] C inhibitor UAW248[5 aa] A 100.0
/100.0
20
/20
R1AB_SARS2 main protease
6zoj[5] FA RS30_HUMAN 40S ribosomal protein S30[56 aa] IA 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 1
6xa9[5] B ISG15_HUMAN ISG15 CTD-propargylamide[80 aa] A 100.0
/100.0
22
/22
R1AB_SARS2 Papain-like protease
6zon[1] S RS30_HUMAN 40S ribosomal protein S30[44 aa] VA 100.0
/100.0
1
/1
R1AB_SARS2 Host translation inhibitor Nsp1
6xez[1] E R1AB_SARS2 nsp13[596 aa] C 100.0
/100.0
1
/1
R1AB_SARS2 nsp7
6xez[2] E R1AB_SARS2 nsp13[596 aa] D 100.0
/100.0
6
/6
R1AB_SARS2 nsp8
6xez[1] E R1AB_SARS2 nsp13[596 aa] A 100.0
/100.0
3
/3
R1AB_SARS2 nsp12
6wuu[5] F VIR250[5 aa] B 100.0
/98.8
16
/16
R1AB_SARS2 papain-like protease
6yva[1] B ISG15_MOUSE Ubiquitin-like protein ISG15[155 aa] A 96.6
/99.6
29
/29
R1A_SARS2 Replicase polyprotein 1a
6xip[8] A R1AB_SARS2 Non-structural protein 7[72 aa] D 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 8
2ahm[17] A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] H 100.0
/97.4
8
/8
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
7bzf[10] C R1AB_SARS2 Non-structural protein 7[68 aa] A 100.0
/100.0
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
2ahm[4] B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] H 100.0
/97.4
3
/3
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
7bv1[8] C R1AB_SARS2 nsp7[63 aa] B 100.0
/100.0
2
/2
R1AB_SARS2 nsp8
6xez[1] C R1AB_SARS2 nsp7[73 aa] E 100.0
/100.0
1
/1
R1AB_SARS2 nsp13
2ahm[4] C R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] H 100.0
/97.4
10
/10
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
6xip[8] C R1AB_SARS2 Non-structural protein 7[75 aa] D 100.0
/100.0
25
/25
R1AB_SARS2 Non-structural protein 8
6yyt[1] C R1AB_SARS2 nsp7[73 aa] B 100.0
/100.0
3
/3
R1AB_SARS2 nsp8
7bw4[1] C R1AB_SARS2 nsp7[65 aa] A 100.0
/100.0
10
/10
R1AB_SARS2 nsp12
3snd[2] C Peptide aldehyde inhibitor Ac-ESTLQ-H[2 aa] A 100.0
/96.1
12
/12
R1A_CVHSA 3C-like proteinase
2z3e[4] B ACE VAL Z3E LEU KCQ peptide[5 aa] A 100.0
/96.1
18
/18
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
3snb[2] B Peptide aldehyde inhibitor Ac-DSFDQ-H[6 aa] A 100.0
/96.1
19
/19
R1A_CVHSA 3C-like proteinase
3sne[2] B Peptide aldehyde inhibitor Ac-ESTLQ-H[6 aa] A 100.0
/96.1
21
/21
R1A_CVHSA 3C-like proteinase
3snc[2] B Peptide aldehyde inhibitor Ac-NSTSQ-H[6 aa] A 100.0
/96.1
18
/18
R1A_CVHSA 3C-like proteinase
3vb7[1] C M4Z inhibitor[4 aa] B 100.0
/96.1
1
/1
R1A_CVHSA 3C-like proteinase
3vb7[2] C M4Z inhibitor[4 aa] A 100.0
/96.0
20
/20
R1A_CVHSA 3C-like proteinase
2z3d[2] B Inhibitor[5 aa] A 100.0
/96.1
18
/18
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
1uk4[2] C 5-mer peptide of inhibitor[5 aa] A 100.0
/96.0
17
/17
R1AB_CVHSA 3C-like proteinase
1uk4[1] E 5-mer peptide of inhibitor[5 aa] B 100.0
/96.0
3
/3
R1AB_CVHSA 3C-like proteinase
3vb4[1] C B4Z inhibitor[5 aa] B 100.0
/96.1
1
/1
R1A_CVHSA 3C-like proteinase
3vb4[4] C B4Z inhibitor[5 aa] A 100.0
/96.0
21
/21
R1A_CVHSA 3C-like proteinase
3vb6[1] D C6Z inhibitor[4 aa] A 100.0
/96.0
1
/1
R1A_CVHSA 3C-like proteinase
3vb6[2] D C6Z inhibitor[4 aa] B 100.0
/96.1
16
/16
R1A_CVHSA 3C-like proteinase
3iwm[14] G N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. C 100.0
/96.0
21
/21
R1A_CVHSA 3C-like proteinase
3iwm[6] G N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. D 100.0
/96.0
1
/1
R1A_CVHSA 3C-like proteinase
2amq[2] C N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/96.0
24
/24
R1AB_CVHSA 3C-like proteinase
3sna[2] B Peptide aldehyde inhibitor Ac-NSFSQ-H[6 aa] A 100.0
/96.0
17
/17
R1A_CVHSA 3C-like proteinase
3aw0[2] B peptide ACE-SER-ALA-VAL-LEU-HIS-H[6 aa] A 100.0
/95.8
18
/18
R1A_CVHSA 3C-Like Proteinase
2q6g[1] C Polypeptide chain[11 aa] A 100.0
/95.7
24
/24
R1AB_CVHSA severe acute respiratory syndrome coronavirus (SAR..
2q6g[1] D Polypeptide chain[8 aa] B 96.0
/95.7
25
/25
R1AB_CVHSA severe acute respiratory syndrome coronavirus (SAR..
3atw[2] C peptide ACE-THR-VAL-ALC-HIS-H[5 aa] A 95.2
/95.7
21
/21
R1A_CVHSA 3C-Like Proteinase
3avz[1] B peptide ACE-SER-ALA-VAL-ALC-HIS-H[6 aa] A 94.7
/95.7
19
/19
R1A_CVHSA 3C-Like Proteinase
5tl7[2] A ISG15_MOUSE Ubiquitin-like protein ISG15[77 aa] B 92.6
/82.9
27
/27
R1AB_CVHSA Replicase polyprotein 1ab
5e6j[2] F UBB_HUMAN Polyubiquitin-B[75 aa] D 70.0
/82.7
10
/10
R1AB_CVHSA Replicase polyprotein 1ab
5e6j[5] B UBC_HUMAN ubiquitin[76 aa] A 92.0
/82.0
25
/25
R1AB_CVHSA Replicase polyprotein 1ab
5yni[12] B K4LC41_9BETC nsp10 protein[120 aa] A 61.9
/66.3
21
/21
K0BWD0_9BETC nsp16 protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7bzf[1] F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/100.0
13
/13
R1AB_SARS2 RNA-directed RNA polymerase
6x1b[6] D DNA (5'-R(*GP*U)-3') B 100.0
/100.0
12
/12
R1AB_SARS2 Uridylate-specific endoribonuclease
7bv2[1] D Primer A 100.0
/100.0
15
/15
R1AB_SARS2 nsp12
7bv2[1] E Templete A 100.0
/100.0
26
/26
R1AB_SARS2 nsp12
6zlw[1] IA 18S ribosomal RNA JA 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 1
6xqb[1] F RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/100.0
19
/19
R1AB_SARS2 RNA-directed RNA polymerase
7bzf[1] E RNA (31-MER) A 100.0
/100.0
25
/25
R1AB_SARS2 RNA-directed RNA polymerase
7c2k[1] E RNA (29-MER) A 100.0
/100.0
24
/24
R1AB_SARS2 RNA-directed RNA polymerase
7c2k[1] E RNA (29-MER) D 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 8
6zoj[1] A 18S ribosomal RNA IA 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 1
6zn5[1] HA 18S ribosomal RNA IA 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 1
6yyt[4] F RNA product D 100.0
/100.0
3
/3
R1AB_SARS2 nsp8
6yyt[1] E RNA product A 100.0
/100.0
14
/14
R1AB_SARS2 nsp12
6zm7[2] WA 18S ribosomal RNA HC 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 1
6xqb[1] E RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/100.0
15
/15
R1AB_SARS2 RNA-directed RNA polymerase
6xez[2] H Template RNA D 100.0
/100.0
1
/1
R1AB_SARS2 nsp8
6xez[1] H Template RNA A 100.0
/100.0
21
/21
R1AB_SARS2 nsp12
6zok[1] A 18S ribosomal RNA U 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 1
7c2k[1] F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/100.0
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
6yyt[1] G RNA product A 100.0
/100.0
26
/26
R1AB_SARS2 nsp12
6yyt[1] G RNA product D 100.0
/100.0
3
/3
R1AB_SARS2 nsp8
6xez[2] G Product RNA B 100.0
/100.0
2
/2
R1AB_SARS2 nsp8
6xez[1] G Product RNA A 100.0
/100.0
16
/16
R1AB_SARS2 nsp12
6zp4[2] R 18S ribosomal RNA BB 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5rha[4] B T8M
1-{4-[(thiophen-2-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rfv[2] E T8J
1-[4-(thiophene-2-carbonyl)piperazin-1-yl]ethan-1-..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5r7y[2] B JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rfu[2] F T8D
1-{4-[(5-chlorothiophen-2-yl)sulfonyl]piperazin-1-..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rft[2] E T8A
1-[(4S)-4-phenyl-3,4-dihydroisoquinolin-2(1H)-yl]e..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rfi[2] E T71
1-{4-[(2,5-dimethylphenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rg0[2] F T8Y
1,1'-(piperazine-1,4-diyl)di(ethan-1-one)[12 atoms..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rfz[2] E T8V
N-(2-chloropyridin-3-yl)acetamide[11 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rgu[2] B UGD
N-(3-{[(2R)-4-oxoazetidin-2-yl]oxy}phenyl)-2-(pyri..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5rfy[2] E T8S
1-acetyl-N-methyl-N-(propan-2-yl)piperidine-4-carb..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rfx[2] E T8P
1-[4-(4-methoxyphenyl)piperazin-1-yl]ethan-1-one[1..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5ynq[5] C SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 94.7
/66.0
19
/19
K0BWD0_9BETC nsp16 protein
6wjt[4] F SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
5c8s[2] S SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
D 100.0
/94.9
15
/15
R1AB_CVHSA Guanine-N7 methyltransferase
6w75[5] W SAM
S-ADENOSYLMETHIONINE[27 atoms]
C 100.0
/100.0
18
/18
R1AB_SARS2 SARS-CoV-2 NSP16
7bq7[7] C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 SARS-CoV-2 nsp16
7c2i[2] C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 Replicase polyprotein 1ab
3r24[1] C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/93.5
19
/19
R1AB_CVHSA 2'-O-methyl transferase
5c8t[2] R SAM
S-ADENOSYLMETHIONINE[27 atoms]
D 100.0
/94.9
15
/15
R1AB_CVHSA Guanine-N7 methyltransferase
5rh9[2] F UJ4
N-{4-[(1S)-1-methoxyethyl]phenyl}-N-[(1R)-2-[(4-me..
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
5re5[2] E T0J
N~1~-phenylpiperidine-1,4-dicarboxamide[18 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6xqt[2] C NNA
(1R,2S,5S)-3-[N-({1-[(tert-butylsulfonyl)methyl]cy..
A 100.0
/100.0
25
/25
R1AB_SARS2 3C-like proteinase
5reh[2] E AWP
1-cyclohexyl-3-(2-pyridin-4-ylethyl)urea[18 atoms]..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5re8[2] E T0V
1-(3-fluorophenyl)-N-[(furan-2-yl)methyl]methanami..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5re7[2] E T0S
N-[(4-sulfamoylphenyl)methyl]acetamide[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
6xqs[5] B SV6
(1S,3aR,6aS)-2-[(2S)-2-({(2S)-2-cyclohexyl-2-[(pyr..
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
5reb[2] E T0Y
1-[(thiophen-3-yl)methyl]piperidin-4-ol[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5re9[2] E LPZ
2-(4-methylphenoxy)-1-(4-methylpiperazin-4-ium-1-y..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
6wlc[6] M U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
6zru[6] D U5G
boceprevir (bound form)[37 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 Main Protease
5red[2] E JJG
4-[2-(phenylsulfanyl)ethyl]morpholine[15 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rfj[2] E T7A
N-(4-methoxy-1,3-benzothiazol-2-yl)acetamide[15 at..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rfl[2] E T7G
1-acetyl-N-(2-hydroxyphenyl)piperidine-4-carboxami..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rfk[2] E T7D
N-(1-acetylpiperidin-4-yl)benzamide[18 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rf8[2] E SFY
4-amino-N-(pyridin-2-yl)benzenesulfonamide[17 atom..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rfm[2] E T7J
N-[(3R)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
6woj[11] H APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
D 100.0
/100.0
23
/23
R1AB_SARS2 Non-structural protein 3
5rfn[2] E T7P
N-[(3R)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rfp[2] E T7V
N-[(1S)-1-(3-chlorophenyl)ethyl]acetamide[13 atoms..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5ynp[5] C SFG
SINEFUNGIN[27 atoms]
A 94.1
/66.0
17
/17
K0BWD0_9BETC nsp16 protein
6wkq[2] G SFG
SINEFUNGIN[27 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 SARS-CoV-2 NSP16
6wq3[1] E 8NK
7-methylguanosine 5'-diphosphate [29 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 2'-O-methyltransferase
5rfs[2] F T84
1-{4-[(thiophen-3-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rfr[2] E T81
1-{4-[(5-bromothiophen-2-yl)methyl]piperazin-1-yl}..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
6yvf[2] B A82
2-[[(1R)-1-(7-methyl-2-morpholin-4-yl-4-oxidanylid..
A 100.0
/100.0
7
/7
R1AB_SARS2 Replicase polyprotein 1ab
5r84[2] B GWS
2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide[16 atoms..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
7c8r[2] B TG3
ethyl (4R)-4-[[(2S)-4-methyl-2-[[(2S,3R)-3-[(2-met..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
7c8r[2] B TG3
ethyl (4R)-4-[[(2S)-4-methyl-2-[[(2S,3R)-3-[(2-met..
A 100.0
/100.0
23
/23
R1AB_SARS2 3C-like proteinase
7bv2[1] K F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-..
A 100.0
/100.0
7
/7
R1AB_SARS2 nsp12
5rh2[2] B UH7
2-(3-chlorophenyl)-N-(4-methylpyridin-3-yl)acetami..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rh0[2] B UH4
N-(5-methylthiophen-2-yl)-N'-pyridin-3-ylurea[16 a..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
4m0w[1] E NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 85.7
/82.3
7
/7
R1A_CVHSA Replicase polyprotein 1a
4m0w[1] F NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 83.3
/82.3
6
/6
R1A_CVHSA Replicase polyprotein 1a
6vxs[2] H NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rgz[2] B UH1
2-(3-cyanophenyl)-N-(pyridin-3-yl)acetamide[18 ato..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
6wxc[6] M CMU
5-CHLORO-6-(1-(2-IMINOPYRROLIDINYL) METHYL) URACIL..
B 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6xez[1] M 1N7
CHAPSO[35 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 nsp12
6xez[1] U 1N7
CHAPSO[36 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 nsp12
6xez[1] N 1N7
CHAPSO[26 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 nsp12
6xez[1] U 1N7
CHAPSO[36 atoms]
E 100.0
/100.0
3
/3
R1AB_SARS2 nsp13
5rgw[2] B UGM
2-(5-cyanopyridin-3-yl)-N-(pyridin-3-yl)acetamide[..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rfo[2] E T7S
1-[4-(piperidine-1-carbonyl)piperidin-1-yl]ethan-1..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rgv[2] B UGG
2-(isoquinolin-4-yl)-N-phenylacetamide[20 atoms]
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgv[2] B UGG
2-(isoquinolin-4-yl)-N-phenylacetamide[20 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rel[2] E T2G
1-{4-[(3-methylphenyl)methyl]piperazin-1-yl}ethan-..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5reo[2] E T2Y
N-[(2H-1,3-benzodioxol-5-yl)methyl]acetamide[14 at..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5re4[2] E SZY
N-(4-methylpyridin-3-yl)acetamide[11 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rgy[2] B UGS
N-(4-methoxypyridin-2-yl)-2-(naphthalen-2-yl)aceta..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
6w6y[1] C AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 100.0
/100.0
16
/16
R1AB_SARS2 SARS-CoV-2 NSP3
5rgx[2] B UGP
2-(3-cyanophenyl)-N-(4-methylpyridin-3-yl)acetamid..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rh1[2] B UGV
2-(5-chlorothiophen-2-yl)-N-(pyridin-3-yl)acetamid..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5ren[2] E T2V
1-[(3R)-3-(1,3-benzothiazol-2-yl)piperidin-1-yl]et..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5rg2[2] E T9M
N~2~-acetyl-N-prop-2-en-1-yl-D-allothreoninamide[1..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
6w4h[1] J BDF
beta-D-fructopyranose[12 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
6w4h[1] G BDF
beta-D-fructopyranose[12 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
6w4h[1] J BDF
beta-D-fructopyranose[12 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 SARS-CoV-2 NSP10
5rhf[2] F UPJ
1-acetyl-N-methyl-N-phenylpiperidine-4-carboxamide..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5ref[2] E 6SU
methyl 3-(methylsulfonylamino)benzoate[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rg1[2] E T9J
Nalpha-acetyl-N-(3-bromoprop-2-yn-1-yl)-L-tyrosina..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rhe[2] B UPD
1-acetyl-N-(6-methoxypyridin-3-yl)piperidine-4-car..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rfe[2] E JGG
N-[(4-cyanophenyl)methyl]morpholine-4-carboxamide[..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
7brp[2] D HU5
(1R,2S,5S)-N-[(1S)-3-AMINO-1-(CYCLOBUTYLMETHYL)-2,..
B 100.0
/100.0
16
/16
R1A_SARS2 3C-like proteinase
6lze[2] F FHR
~{N}-[(2~{S})-3-cyclohexyl-1-oxidanylidene-1-[[(2~..
A 100.0
/100.0
17
/17
R1AB_SARS2 Replicase polyprotein 1ab
5rea[2] E JGP
(azepan-1-yl)(2H-1,3-benzodioxol-5-yl)methanone[18..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rg3[2] F T9P
N~2~-acetyl-N~1~-prop-2-en-1-yl-L-aspartamide[15 a..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rh4[2] B UHG
(2R)-2-(6-chloro-9H-carbazol-2-yl)propanoic acid[1..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rfq[2] E T7Y
N-[3-(2-oxopyrrolidin-1-yl)phenyl]acetamide[16 ato..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rfa[2] D JGY
1-methyl-N-{[(2S)-oxolan-2-yl]methyl}-1H-pyrazole-..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rfa[2] D JGY
1-methyl-N-{[(2S)-oxolan-2-yl]methyl}-1H-pyrazole-..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5ree[2] E T1M
(2R,3R)-1-benzyl-2-methylpiperidin-3-ol[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rh8[2] F UHM
2-(cyanomethoxy)-N-[(1,2-thiazol-4-yl)methyl]benza..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rf9[2] E S7D
1-[(2~{S})-2-methylmorpholin-4-yl]-2-pyrazol-1-yl-..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rec[2] E T1J
2-{[(1H-benzimidazol-2-yl)amino]methyl}phenol[18 a..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rh5[2] B UHV
N-(5-tert-butyl-1,2-oxazol-3-yl)-N-[(1R)-2-[(4-met..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5rej[2] E T1V
1-{4-[(thiophen-2-yl)sulfonyl]piperazin-1-yl}ethan..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
6wvn[2] P MGP
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE[33 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 2'-O-methyltransferase
5rf6[2] E NTG
5-(1,4-oxazepan-4-yl)pyridine-2-carbonitrile[15 at..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
6x4i[6] O U3P
3'-URIDINEMONOPHOSPHATE[21 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
5r82[2] B RZS
6-(ethylamino)pyridine-3-carbonitrile[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rek[2] E T1Y
1-{4-[(3-fluorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rgs[2] E S7V
[(2~{R})-4-(phenylmethyl)morpholin-2-yl]methanol[1..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
6xb2[2] C NEN
1-ETHYL-PYRROLIDINE-2,5-DIONE[9 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6xb1[4] B NEN
1-ETHYL-PYRROLIDINE-2,5-DIONE[9 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5rey[2] E T4Y
1-{4-[(2-methylphenyl)methyl]-1,4-diazepan-1-yl}et..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
6m0k[2] F FJC
~{N}-[(2~{S})-3-(3-fluorophenyl)-1-oxidanylidene-1..
A 100.0
/100.0
17
/17
R1AB_SARS2 Replicase polyprotein 1ab
5rex[2] E T4V
1-{4-[(naphthalen-1-yl)methyl]piperazin-1-yl}ethan..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rh7[2] F UJ1
N-(5-tert-butyl-1H-pyrazol-3-yl)-N-[(1R)-2-[(2-eth..
A 100.0
/100.0
15
/15
R1AB_SARS2 3C-like proteinase
5rev[2] E T4J
N-[3-(thiomorpholine-4-carbonyl)phenyl]acetamide[1..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rhb[2] G USD
(E)-1-(pyrimidin-2-yl)methanimine[8 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rew[2] E T4M
N-[(1R)-1-(naphthalen-1-yl)ethyl]acetamide[16 atom..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
7jiv[2] B VBY
5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
5rf5[2] E HV2
1,1-bis(oxidanylidene)thietan-3-ol[7 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5reu[2] E T4D
2-[(4-acetylpiperazin-1-yl)sulfonyl]benzonitrile[2..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rgh[2] E U0M
5-fluoro-1-[(5-methyl-1,3,4-thiadiazol-2-yl)methyl..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5r7z[2] E HWH
~{N}-[2-(5-fluoranyl-1~{H}-indol-3-yl)ethyl]ethana..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
6wtk[1] B UED
N~2~-[(benzyloxy)carbonyl]-N-{(2S)-1-hydroxy-3-[(3..
A 100.0
/100.0
17
/17
R1AB_SARS2 3C-like proteinase
5r83[2] E K0G
N-phenyl-N'-pyridin-3-ylurea[16 atoms]
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgk[2] E U0V
2-fluoro-N-[2-(pyridin-4-yl)ethyl]benzamide[18 ato..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rgj[2] E U0S
(5S)-7-(pyrazin-2-yl)-2-oxa-7-azaspiro[4.4]nonane[..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rgi[2] E U0P
N'-cyclopropyl-N-methyl-N-[(5-methyl-1,2-oxazol-3-..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rgi[2] E U0P
N'-cyclopropyl-N-methyl-N-[(5-methyl-1,2-oxazol-3-..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
6xez[2] Y ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
F 100.0
/100.0
9
/9
R1AB_SARS2 nsp13
6xez[1] L ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 100.0
/100.0
11
/11
R1AB_SARS2 nsp12
6w63[2] B X77
N-(4-tert-butylphenyl)-N-[(1R)-2-(cyclohexylamino)..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5rgl[2] E U0Y
1-[4-(4-methylbenzene-1-carbonyl)piperazin-1-yl]et..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
6z2e[2] B Q5T
(4~{S})-4-[[(2~{S})-2-[[(2~{S})-2-[[(2~{S})-2-[3-[..
A 100.0
/100.0
21
/21
R1AB_SARS2 Main Protease
6wvn[1] Q ADE
ADENINE[10 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] R ADE
ADENINE[10 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wks[2] D ADN
ADENOSINE[19 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 2'-O-methyltransferase
6y2f[4] C O6K
~{tert}-butyl ~{N}-[1-[(2~{S})-3-cyclopropyl-1-oxi..
A 100.0
/100.0
18
/18
R1AB_SARS2 Replicase polyprotein 1ab
6y2g[1] D O6K
~{tert}-butyl ~{N}-[1-[(2~{S})-3-cyclopropyl-1-oxi..
B 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6xhl[4] C V2M
N-[(2S)-1-({(2S)-4-hydroxy-3-oxo-1-[(3S)-2-oxopyrr..
A 100.0
/96.0
18
/18
R1A_CVHSA 3C-like proteinase
6xhm[1] C V2M
N-[(2S)-1-({(2S)-4-hydroxy-3-oxo-1-[(3S)-2-oxopyrr..
B 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rer[2] E T3J
1-[(2R)-2-(4-fluorophenyl)morpholin-4-yl]ethan-1-o..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
6m2n[4] F 3WL
5,6,7-trihydroxy-2-phenyl-4H-chromen-4-one[20 atom..
B 100.0
/100.0
15
/15
SARS-CoV-2 3CL protease
5rgn[2] E U1A
1-{4-[(4-methylphenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rep[2] E T3G
1-{4-[(2,6-difluorophenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rfc[2] E K1Y
methyl (2-methyl-4-phenyl-1,3-thiazol-5-yl)carbama..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rh3[2] B UHA
(2R)-2-(3-chlorophenyl)-N-(4-methylpyridin-3-yl)pr..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5ret[2] E T47
1-{4-[(3-chlorophenyl)methyl]piperazin-1-yl}ethan-..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgm[2] E U1D
N'-acetyl-4,5,6,7-tetrahydro-1-benzothiophene-2-ca..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgo[2] E U1G
1-[4-(furan-2-carbonyl)piperazin-1-yl]ethan-1-one[..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rgr[2] E K1G
N,1-dimethyl-N-(propan-2-yl)-1H-pyrazolo[3,4-d]pyr..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rgr[2] D K1G
N,1-dimethyl-N-(propan-2-yl)-1H-pyrazolo[3,4-d]pyr..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
7buy[2] B JRY
hexylcarbamic acid[9 atoms]
A 100.0
/100.0
8
/8
SARS-CoV-2 virus Main protease
5rgq[2] D U1V
1-(4-fluoro-2-methylphenyl)methanesulfonamide[13 a..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rgq[2] D U1V
1-(4-fluoro-2-methylphenyl)methanesulfonamide[13 a..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
7c8u[6] B K36
(1S,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino..
A 100.0
/100.0
13
/13
R1AB_SARS2 Replicase polyprotein 1ab
5rfh[2] E T6Y
1-{4-[(5-chlorothiophen-2-yl)methyl]piperazin-1-yl..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rhc[2] B USA
(E)-1-(1H-imidazol-2-yl)methanimine[7 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
6yt8[2] B PK8
9-oxa-7-thia-1-azonia-8$l^{2}-zincabicyclo[4.3.0]n..
A 100.0
/100.0
6
/6
R1AB_SARS2 Replicase polyprotein 1ab
5rfg[2] E T6V
N-[(3S)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
7jn2[1] B Y41
3-amino-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]..
A 100.0
/100.0
10
/10
R1A_SARS2 Papain-Like Protease
5rff[2] E T6M
1-{4-[(4-chlorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rfd[2] E T6J
2-[(methylsulfonyl)methyl]-1H-benzimidazole[14 ato..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rgp[2] E U1M
1-{4-[(2,4-dimethylphenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5reg[2] E LWA
(2~{S})-~{N}-(4-aminocarbonylphenyl)oxolane-2-carb..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
6ynq[2] B P6N
(2~{S})-2-methyl-3,4-dihydro-2~{H}-naphthalen-1-on..
A 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6ynq[2] B P6N
(2~{S})-2-methyl-3,4-dihydro-2~{H}-naphthalen-1-on..
A 100.0
/100.0
8
/8
R1AB_SARS2 Replicase polyprotein 1ab
6wtt[1] N UCS
N~2~-[(benzyloxy)carbonyl]-N-[(1R,2S)-1-hydroxy-3-..
B 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
6wtt[1] N UCS
N~2~-[(benzyloxy)carbonyl]-N-[(1R,2S)-1-hydroxy-3-..
C 100.0
/100.0
20
/20
R1AB_SARS2 3C-like proteinase
5rez[2] E T54
(1R,2S)-2-(thiophen-3-yl)cyclopentane-1-carboxamid..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
7c7p[1] E FK3
(3~{S},3~{a}~{S},6~{a}~{R})-~{N}-[(2~{R},3~{S})-1-..
B 100.0
/100.0
13
/13
R1AB_SARS2 main protease
5rgt[2] F UHS
N-[(1R)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5r80[2] E RZG
methyl 4-sulfamoylbenzoate[14 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rf4[2] E T5Y
pyridin-2-ol[7 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5re6[2] E O0S
N-{4-[(pyrimidin-2-yl)oxy]phenyl}acetamide[17 atom..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rei[2] E T1S
4-[(3-chlorophenyl)methyl]morpholine[14 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5r81[2] B RZJ
1-methyl-3,4-dihydro-2~{H}-quinoline-7-sulfonamide..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rf3[2] E T5V
pyrimidin-5-amine[7 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rem[2] E T2J
1 1-(4-(2-nitrophenyl)piperazin-1-yl)ethan-1-one[1..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rgg[2] E NZD
4-methyl-N-phenylpiperazine-1-carboxamide[16 atoms..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rf0[2] E T5D
[1-(pyridin-2-yl)cyclopentyl]methanol[13 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5rf0[2] E T5D
[1-(pyridin-2-yl)cyclopentyl]methanol[13 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rf1[2] E T5G
4-bromobenzene-1-sulfonamide[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5res[2] E T3V
1-{4-[(2-fluorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rfb[2] E K3S
N-[(1-methyl-1H-1,2,3-triazol-4-yl)methyl]ethanami..
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5rf7[2] E T67
1-(4-methylpiperazin-1-yl)-2-(1H-pyrrolo[2,3-b]pyr..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5rhd[2] I US7
1-[4-(methylsulfonyl)phenyl]piperazine[16 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rh6[2] F UHY
N-[(1R)-2-[(2-ethyl-6-methylphenyl)amino]-2-oxo-1-..
A 100.0
/100.0
15
/15
R1AB_SARS2 3C-like proteinase
7jit[1] B Y95
5-[(carbamoylcarbamoyl)amino]-2-methyl-N-[(1R)-1-(..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
2op9[2] C WR1
NALPHA-[(BENZYLOXY)CARBONYL]-N-[(1R)-4-HYDROXY-1-M..
A 100.0
/96.0
13
/13
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like ..
6lny[1] B EOC
(2~{S})-4-methyl-~{N}-[(2~{S})-1-oxidanylidene-3-[..
A 100.0
/96.1
16
/16
R1A_CVHSA Replicase polyprotein 1a
2vj1[1] G XP1
4-(DIMETHYLAMINO)BENZOIC ACID[8 atoms]
B 100.0
/96.0
6
/6
A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
2v6n[2] B XP1
4-(DIMETHYLAMINO)BENZOIC ACID[11 atoms]
A 100.0
/96.1
10
/10
R1AB_CVHSA REPLICASE POLYPROTEIN 1AB
5n5o[2] B 8O5
(2~{R},3~{S})-3-[[(2~{S})-3-cyclopropyl-2-[[(~{E})..
A 100.0
/96.1
17
/17
R1AB_CVHSA Replicase polyprotein 1ab
6wco[2] D X47
N-(4-tert-butylphenyl)-N-[(1R)-2-(cyclopentylamino..
A 100.0
/96.1
17
/17
A0A3G5BIY8_CVHSA Main protease
6y7m[2] B OEW
~{tert}-butyl ~{N}-[1-[(2~{S})-3-cyclohexyl-1-[[(2..
A 100.0
/96.1
20
/20
R1A_CVHSA Replicase polyprotein 1a
5n19[2] B D03
(S)-N-benzyl-3-((S)-2-cinnamamido-3-phenylpropanam..
A 95.2
/96.1
21
/21
R1AB_CVHSA SARS coronavirus main protease
3szn[2] B G75
ETHYL (4R)-4-({N-[(BENZYLOXY)CARBONYL]-L-PHENYLALA..
A 100.0
/96.1
17
/17
R1A_CVHSA 3C-like proteinase
2gx4[2] B NOL
N-[(BENZYLOXY)CARBONYL]-O-(TERT-BUTYL)-L-THREONYL-..
A 100.0
/96.1
1
/1
R1AB_CVHSA 3C-like proteinase
7c8t[4] B NOL
N-[(BENZYLOXY)CARBONYL]-O-(TERT-BUTYL)-L-THREONYL-..
A 100.0
/100.0
23
/23
R1AB_SARS2 3C-like proteinase
2gz8[2] B F3F
S-[5-(TRIFLUOROMETHYL)-4H-1,2,4-TRIAZOL-3-YL] 5-(P..
A 100.0
/96.1
14
/14
R1AB_CVHSA Replicase polyprotein 1ab
2z94[2] C TLD
4-methylbenzene-1,2-dithiol[9 atoms]
A 100.0
/96.1
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
2zu4[2] B ZU3
N-[(benzyloxy)carbonyl]-3-[(2,2-dimethylpropanoyl)..
A 100.0
/96.1
22
/22
R1A_CVHSA 3C-like proteinase
2zu4[2] B ZU3
N-[(benzyloxy)carbonyl]-3-[(2,2-dimethylpropanoyl)..
A 100.0
/96.1
1
/1
R1A_CVHSA 3C-like proteinase
2zu5[2] B ZU5
N-[(benzyloxy)carbonyl]-O-tert-butyl-L-threonyl-N-..
A 100.0
/96.1
1
/1
R1A_CVHSA 3C-like proteinase
2zu5[2] B ZU5
N-[(benzyloxy)carbonyl]-O-tert-butyl-L-threonyl-N-..
A 100.0
/96.1
22
/22
R1A_CVHSA 3C-like proteinase
3sn8[2] B S89
N-[(2S)-1-hydroxy-3-phenylpropan-2-yl]-Nalpha-[(2E..
A 100.0
/96.1
15
/15
R1A_CVHSA 3C-like proteinase
6lo0[1] B EOF
(2~{S})-4-methyl-~{N}-[(2~{S})-1-oxidanylidene-3-[..
A 100.0
/96.1
18
/18
R1A_CVHSA Replicase polyprotein 1a
6lnq[1] B EJF
N-[(2S)-3-methyl-1-[[(2S)-4-methyl-1-oxidanylidene..
A 100.0
/96.1
19
/19
Severe Acute Respiratory Syndrome Coronavirus 3c L..
3tnt[2] B G85
N-[(benzyloxy)carbonyl]-O-tert-butyl-L-seryl-N-{(2..
A 100.0
/96.1
22
/22
R1A_CVHSA SARS coronavirus main protease
3v3m[2] B 0EN
N-[(1R)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)..
A 100.0
/96.1
15
/15
R1A_CVHSA 3C-like proteinase
3tit[2] B G81
ETHYL (4R)-4-{[N-(TERT-BUTOXYCARBONYL)-L-PHENYLALA..
A 100.0
/96.1
15
/15
R1A_CVHSA SARS coronavirus main protease
3tiu[2] C G82
ETHYL (5S,8S,11R)-8-BENZYL-5-(3-TERT-BUTOXY-3-OXOP..
A 100.0
/96.1
23
/23
R1A_CVHSA SARS coronavirus main protease
3tns[2] B G83
ETHYL (5S,8S,11R)-8-BENZYL-5-(2-TERT-BUTOXY-2-OXOE..
A 100.0
/96.1
1
/1
R1A_CVHSA SARS coronavirus main protease
3tns[2] B G83
ETHYL (5S,8S,11R)-8-BENZYL-5-(2-TERT-BUTOXY-2-OXOE..
A 100.0
/96.1
24
/24
R1A_CVHSA SARS coronavirus main protease
2gz7[2] B D3F
2-[(2,4-DICHLORO-5-METHYLPHENYL)SULFONYL]-1,3-DINI..
A 100.0
/96.1
13
/13
R1AB_CVHSA Replicase polyprotein 1ab
2amd[2] D 9IN
N-(3-FUROYL)-D-VALYL-L-VALYL-N~1~-((1R,2Z)-4-ETHOX..
B 100.0
/96.0
22
/22
R1AB_CVHSA 3C-like proteinase
2d2d[2] C ENB
ETHYL (2E,4S)-4-[((2R)-2-{[N-(TERT-BUTOXYCARBONYL)..
A 100.0
/96.0
21
/21
R1AB_CVHSA 3C-like proteinase
1wof[2] C I12
N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]-L-ALANYL-L-VAL..
A 100.0
/96.1
23
/23
R1AB_CVHSA 3C-like proteinase
2alv[2] B CY6
N-((3S,6R)-6-((S,E)-4-ETHOXYCARBONYL-1-((S)-2-OXOP..
A 100.0
/96.0
24
/24
R1AB_CVHSA Replicase polyprotein 1ab
4mds[2] B 23H
N-[4-(acetylamino)phenyl]-2-(1H-benzotriazol-1-yl)..
A 94.4
/96.0
18
/18
R1A_CVHSA 3C-like proteinase
6xhn[2] E V3D
(3S)-3-{[N-(4-methoxy-1H-indole-2-carbonyl)-L-leuc..
B 100.0
/96.0
18
/18
R1A_CVHSA 3C-like proteinase
2vj1[1] D BEZ
BENZOIC ACID[9 atoms]
A 100.0
/96.0
8
/8
A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
2a5k[6] C AZP
(5S,8S,14R)-ETHYL 11-(3-AMINO-3-OXOPROPYL)-8-BENZY..
A 100.0
/96.1
24
/24
R1AB_CVHSA 3C-like peptidase
3d62[2] B 959
benzyl (2-oxopropyl)carbamate[15 atoms]
A 100.0
/96.0
10
/10
R1AB_CVHSA 3C-like proteinase
6xho[2] D V34
ethyl (2E,4S)-4-{[N-(4-methoxy-1H-indole-2-carbony..
A 100.0
/96.0
19
/19
R1A_CVHSA 3C-like proteinase
4wy3[1] B 3X5
(2S)-2-({[(3R,4aS,8aR)-2-(biphenyl-4-ylcarbonyl)de..
A 93.8
/95.8
16
/16
R1AB_CVHSA 3C-like proteinase
4twy[2] B 3BL
(2S)-2-({[(3S,4aR,8aS)-2-(biphenyl-4-ylcarbonyl)de..
A 88.9
/95.8
18
/18
R1AB_CVHSA 3C-like proteinase
5c5n[2] B SLH
(2S)-3-(1H-imidazol-5-yl)-2-({[(3R,4aS,8aR)-2-(N-p..
A 93.3
/95.8
15
/15
R1AB_CVHSA 3C-like proteinase
4tww[2] C 3A7
(2S)-2-({[(3S,4aR,8aS)-2-(4-bromobenzoyl)decahydro..
A 93.3
/95.8
15
/15
R1AB_CVHSA 3C-like proteinase
6xmk[3] D QYS
(1S,2S)-2-[(N-{[(4,4-difluorocyclohexyl)methoxy]ca..
B 100.0
/100.0
18
/18
R1AB_SARS2 3C-like proteinase
6w2a[1] C VDJ
[4,4-bis(fluoranyl)cyclohexyl]methyl ~{N}-[(2~{S})..
A 100.0
/95.7
16
/16
R1A_CVHSA Replicase polyprotein 1a
2qiq[2] B CYV
ETHYL (4R)-4-{[(2R,5S)-5-{[N-(TERT-BUTOXYCARBONYL)..
A 100.0
/95.7
23
/23
R1AB_CVHSA Replicase polyprotein 1ab
5c5o[2] D SDJ
(2S)-3-(1H-imidazol-5-yl)-2-({[(3S,4aR,8aS)-2-(N-p..
B 88.9
/95.7
18
/18
R1AB_CVHSA 3C-like proteinase
5c8s[2] T G3A
GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms..
D 100.0
/94.9
16
/16
R1AB_CVHSA Guanine-N7 methyltransferase
7jir[2] B TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
3mj5[2] C GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale..
B 100.0
/81.3
4
/4
R1A_CVHSA Replicase polyprotein 1a
3mj5[2] E GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale..
B 100.0
/81.3
11
/11
R1A_CVHSA Replicase polyprotein 1a
4ovz[2] G P85
N-[(4-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-..
B 100.0
/81.3
11
/11
R1A_CVHSA Papain-like proteinase
4ow0[2] D S88
N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-..
A 100.0
/82.6
10
/10
R1A_CVHSA papain-like protease
5ynp[6] D GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 88.2
/66.0
17
/17
K0BWD0_9BETC nsp16 protein
6wvn[3] O GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 100.0
/100.0
17
/17
R1AB_SARS2 2'-O-methyltransferase
5yni[4] D GTG
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52..
A 87.5
/66.3
16
/16
K0BWD0_9BETC nsp16 protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6wtt[1] O CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
6wtt[1] L CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
7jit[10] I CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
6xkf[11] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
6wtt[2] I CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
2xyv[3] H CL
CHLORIDE ION[1 atoms]
A 100.0
/94.4
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wtt[15] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5r7y[3] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6wvn[2] DA CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6yt8[2] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
6wzu[8] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
7c7p[1] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 main protease
6wen[3] B CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
6vww[3] L CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6yvf[2] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6z2e[2] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Main Protease
2xyr[2] F CL
CHLORIDE ION[1 atoms]
A 66.7
/94.1
3
/3
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2a5a[2] B CL
CHLORIDE ION[1 atoms]
A 100.0
/96.1
2
/2
R1AB_CVHSA 3C-like peptidase
7jir[2] J CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
3e9s[1] E CL
CHLORIDE ION[1 atoms]
A 75.0
/82.7
4
/4
R1A_CVHSA Non-structural protein 3
6wrz[4] O CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] K CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wrz[2] U CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 10
2xyq[3] D CL
CHLORIDE ION[1 atoms]
A 100.0
/93.7
3
/3
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wvn[1] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wzu[3] F CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
6yvf[2] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
6xkm[1] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] CA CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 10
6w61[1] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
2xyv[1] I CL
CHLORIDE ION[1 atoms]
A 100.0
/94.4
2
/2
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wrz[1] P CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] L CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] H CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
7jn2[2] N UNX
UNKNOWN ATOM OR ION[1 atoms]
A 100.0
/100.0
1
/1
R1A_SARS2 Papain-Like Protease
6wjt[6] E NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6w75[1] U NA
SODIUM ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
2xyv[3] C NA
SODIUM ION[1 atoms]
A 100.0
/94.4
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyv[1] E NA
SODIUM ION[1 atoms]
A 100.0
/94.4
4
/4
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
4ovz[3] H NA
SODIUM ION[1 atoms]
B 100.0
/81.3
5
/5
R1A_CVHSA Papain-like proteinase
5y3e[2] E NA
SODIUM ION[1 atoms]
A 83.3
/82.8
6
/6
R1A_CVHSA Replicase polyprotein 1a
5y3q[2] G NA
SODIUM ION[1 atoms]
A 100.0
/82.8
3
/3
R1A_CVHSA Replicase polyprotein 1a
5y3e[2] G NA
SODIUM ION[1 atoms]
A 100.0
/82.8
7
/7
R1A_CVHSA Replicase polyprotein 1a
6xbg[1] H NA
SODIUM ION[1 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 main protease
6w75[1] R NA
SODIUM ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP10
5y3q[2] E NA
SODIUM ION[1 atoms]
A 40.0
/82.8
5
/5
R1A_CVHSA Replicase polyprotein 1a
2xyq[2] G NA
SODIUM ION[1 atoms]
A 100.0
/93.7
6
/6
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6w75[1] JA NA
SODIUM ION[1 atoms]
D 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP10
6z2e[2] E NA
SODIUM ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Main Protease
6w75[1] T NA
SODIUM ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[3] V NA
SODIUM ION[1 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
6xbi[1] G NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 main protease
6x4i[3] P NA
SODIUM ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
4m0w[1] D NA
SODIUM ION[1 atoms]
A 20.0
/82.3
5
/5
R1A_CVHSA Replicase polyprotein 1a
6xbh[2] D NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 main protease
6yvf[2] L CA
CALCIUM ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
2z9g[2] B HG
MERCURY (II) ION[1 atoms]
A 100.0
/96.1
4
/4
R1AB_CVHSA 3C-like proteinase
1uk4[2] G ATO
CHLOROACETONE[1 atoms]
B 100.0
/96.0
4
/4
R1AB_CVHSA 3C-like proteinase
6xez[2] AA MG
MAGNESIUM ION[1 atoms]
F 100.0
/100.0
3
/3
R1AB_SARS2 nsp13
7bv2[1] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 nsp12
6vww[3] E MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6wuu[1] K MG
MAGNESIUM ION[1 atoms]
B 100.0
/98.8
1
/1
R1AB_SARS2 papain-like protease
6wtt[3] J MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
2xyr[3] I MG
MAGNESIUM ION[1 atoms]
A 0.0
/94.1
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6xez[1] K MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 nsp12
6wuu[1] O MG
MAGNESIUM ION[1 atoms]
D 100.0
/99.7
5
/5
R1AB_SARS2 papain-like protease
5c8t[4] Q MG
MAGNESIUM ION[1 atoms]
D 100.0
/94.9
3
/3
R1AB_CVHSA Guanine-N7 methyltransferase
6ywm[1] O MG
MAGNESIUM ION[1 atoms]
C 100.0
/98.8
1
/1
R1AB_SARS2 NSP3 macrodomain
6xqb[2] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
6ywk[2] I MG
MAGNESIUM ION[1 atoms]
C 100.0
/100.0
1
/4
R1AB_SARS2 NSP3 macrodomain
6wtt[1] M MG
MAGNESIUM ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5c8s[2] J MG
MAGNESIUM ION[1 atoms]
B 100.0
/94.9
3
/3
R1AB_CVHSA Guanine-N7 methyltransferase
6wuu[1] P MG
MAGNESIUM ION[1 atoms]
D 100.0
/99.7
2
/2
R1AB_SARS2 papain-like protease
7jit[12] D ZN
ZINC ION[1 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
7jit[22] F ZN
ZINC ION[1 atoms]
A 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
4ow0[40] H ZN
ZINC ION[1 atoms]
B 80.0
/81.1
5
/5
R1A_CVHSA papain-like protease
5nfy[4] R ZN
ZINC ION[1 atoms]
C 100.0
/94.7
4
/4
Q1T6X8_CVHSA Polyprotein 1ab
6wuu[5] N ZN
ZINC ION[1 atoms]
D 100.0
/99.7
4
/4
R1AB_SARS2 papain-like protease
7c2k[3] H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
7c2i[2] E ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
7bw4[1] E ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 nsp12
7bv2[3] F ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 nsp12
5nfy[4] W ZN
ZINC ION[1 atoms]
D 100.0
/94.7
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
5wwp[6] C ZN
ZINC ION[1 atoms]
A 100.0
/72.3
4
/4
K0BWD0_9BETC ORF1ab
5wwp[9] E ZN
ZINC ION[1 atoms]
A 100.0
/72.3
4
/4
K0BWD0_9BETC ORF1ab
6xez[2] V ZN
ZINC ION[1 atoms]
F 100.0
/100.0
5
/5
R1AB_SARS2 nsp13
6w9c[3] D ZN
ZINC ION[1 atoms]
C 100.0
/100.0
1
/1
R1A_SARS2 Papain-like proteinase
6yyt[1] I ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 nsp12
5nfy[4] N ZN
ZINC ION[1 atoms]
B 100.0
/94.7
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
6yyt[1] J ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 nsp12
5c8s[2] I ZN
ZINC ION[1 atoms]
B 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
6xqb[3] H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
6xez[2] X ZN
ZINC ION[1 atoms]
F 100.0
/100.0
4
/4
R1AB_SARS2 nsp13
6wks[3] G ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 10
7jit[5] E ZN
ZINC ION[1 atoms]
A 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
6yz1[1] E ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 nsp10
6xez[3] I ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 nsp12
5c8t[4] O ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
6w61[1] I ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 10
6wkq[11] N ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP10
5c8u[4] O ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
7jn2[2] G ZN
ZINC ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-Like Protease
6nur[3] E ZN
ZINC ION[1 atoms]
A 100.0
/97.0
4
/4
R1AB_CVHSA NSP12
5c8s[2] P ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[2] O ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
7bw4[1] F ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 nsp12
6xez[3] J ZN
ZINC ION[1 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 nsp12
2fe8[6] G BR
BROMIDE ION[1 atoms]
A 100.0
/82.8
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] F BR
BROMIDE ION[1 atoms]
A 100.0
/82.8
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] O BR
BROMIDE ION[1 atoms]
C 75.0
/82.7
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
5e6j[1] H NI
NICKEL (II) ION[1 atoms]
A 0.0
/82.0
2
/2
R1AB_CVHSA Replicase polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6w4b[4] A R1AB_SARS2 Non-structural protein 9[109 aa] B 94.4
/97.4
18
/18
R1AB_SARS2 Non-structural protein 9
6w9q[2] A R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. A 83.3
/91.9
24
/24
R1AB_SARS2 3C-like proteinase peptide, Non-structural protein..
6wks[2] A R1AB_SARS2 2'-O-methyltransferase[298 aa] A 100.0
/100.0
17
/17
R1AB_SARS2 2'-O-methyltransferase
6x4i[42] A R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] A 100.0
/100.0
29
/29
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[42] B R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] B 100.0
/100.0
24
/24
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[36] B R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] A 100.0
/100.0
15
/17
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[12] A R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6wks[2] B R1AB_SARS2 Non-structural protein 10[114 aa] B 100.0
/100.0
11
/11
R1AB_SARS2 Non-structural protein 10
6xez[1] E R1AB_SARS2 nsp13[596 aa] F 100.0
/100.0
5
/5
R1AB_SARS2 nsp13
6xez[1] F R1AB_SARS2 nsp13[596 aa] E 100.0
/100.0
4
/4
R1AB_SARS2 nsp13
6w9c[6] A R1A_SARS2 Papain-like proteinase[313 aa] C 100.0
/100.0
3
/3
R1A_SARS2 Papain-like proteinase
6xg3[2] A R1AB_SARS2 Peptidase C16[313 aa] A 100.0
/99.7
24
/24
R1AB_SARS2 Peptidase C16
6xip[8] C R1AB_SARS2 Non-structural protein 7[75 aa] A 100.0
/97.2
5
/5
R1AB_SARS2 Non-structural protein 7
2ahm[4] E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] G 100.0
/97.4
7
/7
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[4] E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] G 100.0
/97.4
7
/7
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[4] H R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] G 100.0
/97.4
9
/9
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[2] E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] H 100.0
/97.4
7
/7
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
5rgm[520] A R1AB_SARS2 3C-like proteinase[304 aa] A 100.0
/100.0
37
/37
R1AB_SARS2 3C-like proteinase
3iwm[8] A R1A_CVHSA 3C-like proteinase[301 aa] B 0.0
/96.0
2
/2
R1A_CVHSA 3C-like proteinase
3iwm[8] A R1A_CVHSA 3C-like proteinase[301 aa] C 97.2
/96.0
72
/72
R1A_CVHSA 3C-like proteinase
3iwm[4] C R1A_CVHSA 3C-like proteinase[300 aa] C 100.0
/96.0
7
/7
R1A_CVHSA 3C-like proteinase
2gtb[2] A R1AB_CVHSA 3C-like proteinase[299 aa] A 100.0
/96.0
2
/2
R1AB_CVHSA 3C-like proteinase
3iwm[8] B R1A_CVHSA 3C-like proteinase[301 aa] C 100.0
/96.0
4
/4
R1A_CVHSA 3C-like proteinase
3iwm[8] B R1A_CVHSA 3C-like proteinase[301 aa] C 100.0
/96.0
4
/4
R1A_CVHSA 3C-like proteinase
2z3e[2] A R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)[306 aa] A 80.0
/96.1
5
/5
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
2rhb[12] F R1AB_CVHSA Uridylate-specific endoribonuclease[344 aa] D 86.7
/88.4
30
/30
R1AB_CVHSA Uridylate-specific endoribonuclease
2ozk[4] D R1AB_CVHSA Uridylate-specific endoribonuclease[296 aa] B 84.6
/88.5
13
/13
R1AB_CVHSA Uridylate-specific endoribonuclease
2rhb[6] C R1AB_CVHSA Uridylate-specific endoribonuclease[345 aa] F 92.9
/88.4
14
/14
R1AB_CVHSA Uridylate-specific endoribonuclease
2ozk[2] A R1AB_CVHSA Uridylate-specific endoribonuclease[306 aa] B 87.1
/88.5
31
/31
R1AB_CVHSA Uridylate-specific endoribonuclease
2h85[6] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 93.3
/88.2
15
/16
Q6VA80_CVHSA Putative orf1ab polyprotein
2h85[6] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 85.2
/88.2
27
/27
Q6VA80_CVHSA Putative orf1ab polyprotein
2rhb[6] F R1AB_CVHSA Uridylate-specific endoribonuclease[344 aa] E 88.0
/88.4
25
/25
R1AB_CVHSA Uridylate-specific endoribonuclease
2ozk[2] B R1AB_CVHSA Uridylate-specific endoribonuclease[305 aa] D 90.0
/88.5
20
/20
R1AB_CVHSA Uridylate-specific endoribonuclease
2ozk[2] C R1AB_CVHSA Uridylate-specific endoribonuclease[291 aa] B 66.7
/88.5
3
/3
R1AB_CVHSA Uridylate-specific endoribonuclease
2fe8[8] C R1AB_CVHSA Replicase polyprotein 1ab[313 aa] A 77.8
/82.8
18
/18
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] A 87.0
/82.8
23
/23
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] A 75.0
/82.8
8
/9
R1AB_CVHSA Replicase polyprotein 1ab
2wct[6] C R1A_CVHSA NON-STRUCTURAL PROTEIN 3[252 aa] B 79.2
/76.3
24
/24
R1A_CVHSA NON-STRUCTURAL PROTEIN 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xdh[3] K ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[6] H ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
7jit[3] K ACT
ACETATE ION[4 atoms]
A 85.7
/99.7
7
/7
R1A_SARS2 Papain-like protease
6wlc[4] T ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] Q ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[6] C ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6w4h[1] E ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6wlc[3] F ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
6xkh[2] H ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6wlc[3] S ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
5e6j[1] G ACT
ACETATE ION[4 atoms]
A 83.3
/82.0
6
/6
R1AB_CVHSA Replicase polyprotein 1ab
6w4h[1] F ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 SARS-CoV-2 NSP16
7jn2[1] L ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-Like Protease
6y2g[1] C GLY
GLYCINE[4 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6y2g[1] C GLY
GLYCINE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
5rg3[240] B DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rf1[250] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rf1[252] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rgy[12] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rgy[64] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rgx[48] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rgp[236] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
6xbi[1] H DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 main protease
6lze[16] B DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Replicase polyprotein 1ab
4ow0[1] J DMS
DIMETHYL SULFOXIDE[4 atoms]
B 50.0
/81.1
2
/2
R1A_CVHSA papain-like protease
5rfw[18] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
2vj1[3] F DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/96.0
3
/3
A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
4ovz[1] J DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/81.3
3
/3
R1A_CVHSA Papain-like proteinase
4mds[16] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.0
3
/3
R1A_CVHSA 3C-like proteinase
6yvf[6] H DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
4ovz[3] K DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/81.3
4
/4
R1A_CVHSA Papain-like proteinase
7buy[2] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
4
/4
SARS-CoV-2 virus Main protease
7buy[2] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
SARS-CoV-2 virus Main protease
4ovz[1] L DMS
DIMETHYL SULFOXIDE[4 atoms]
B 66.7
/81.3
6
/6
R1A_CVHSA Papain-like proteinase
5reg[16] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
6yz6[2] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Main Protease
6m0k[2] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
3tiu[2] B DMS
DIMETHYL SULFOXIDE[4 atoms]
A 83.3
/96.1
6
/6
R1A_CVHSA SARS coronavirus main protease
4ow0[1] G DMS
DIMETHYL SULFOXIDE[4 atoms]
A 60.0
/82.6
5
/5
R1A_CVHSA papain-like protease
2vj1[1] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.0
1
/1
A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
6w01[12] N CIT
CITRIC ACID[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
6wtc[1] F ACY
ACETIC ACID[4 atoms]
C 100.0
/98.6
1
/1
R1AB_SARS2 SARS-CoV-2 NSP7
6wtc[1] F ACY
ACETIC ACID[4 atoms]
D 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP8
2gtb[2] C ACY
ACETIC ACID[4 atoms]
A 100.0
/96.0
5
/5
R1AB_CVHSA 3C-like proteinase
6vww[3] O ACY
ACETIC ACID[4 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] H ACY
ACETIC ACID[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wtc[1] E ACY
ACETIC ACID[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP7
6wtc[1] E ACY
ACETIC ACID[4 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP8
6vww[3] P ACY
ACETIC ACID[4 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6ywk[2] DA EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
E 100.0
/100.0
6
/6
R1AB_SARS2 NSP3 macrodomain
6ywk[1] CA EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
E 100.0
/100.0
11
/11
R1AB_SARS2 NSP3 macrodomain
7bv2[1] H POP
PYROPHOSPHATE 2-[9 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 nsp12
6xmk[1] E PG4
TETRAETHYLENE GLYCOL[13 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
6zsl[4] K PO4
PHOSPHATE ION[5 atoms]
B 100.0
/100.0
7
/7
R1AB_SARS2 SARS-CoV-2 helicase NSP13
6xg3[3] C PO4
PHOSPHATE ION[5 atoms]
A 83.3
/99.7
6
/6
R1AB_SARS2 Peptidase C16
6wrh[2] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
6wzu[2] E PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
6wxc[12] N PO4
PHOSPHATE ION[5 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6w9q[2] B PO4
PHOSPHATE ION[5 atoms]
A 100.0
/91.9
1
/1
R1AB_SARS2 3C-like proteinase peptide, Non-structural protein..
6xez[2] Z AF3
ALUMINUM FLUORIDE[4 atoms]
F 100.0
/100.0
6
/6
R1AB_SARS2 nsp13
6vww[6] F GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6xbg[16] G GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 main protease
6vww[6] G GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6xbi[1] F GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 main protease
6wtt[2] F GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6xa9[16] I GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Papain-like protease
4ow0[1] F GOL
GLYCEROL[6 atoms]
A 66.7
/82.6
3
/3
R1A_CVHSA papain-like protease
5y3e[2] I GOL
GLYCEROL[6 atoms]
A 100.0
/82.8
6
/6
R1A_CVHSA Replicase polyprotein 1a
6wrh[2] I GOL
GLYCEROL[6 atoms]
A 100.0
/99.7
6
/6
R1AB_SARS2 Non-structural protein 3
6xa9[2] L GOL
GLYCEROL[6 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 Papain-like protease
6xa9[2] P GOL
GLYCEROL[6 atoms]
E 100.0
/100.0
2
/2
R1AB_SARS2 Papain-like protease
5y3e[1] J GOL
GLYCEROL[6 atoms]
A 100.0
/82.8
5
/5
R1A_CVHSA Replicase polyprotein 1a
6vww[3] I GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
2z3e[2] D GOL
GLYCEROL[6 atoms]
A 100.0
/96.1
4
/4
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
6vww[3] N GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
5y3e[3] H GOL
GLYCEROL[6 atoms]
A 66.7
/82.8
6
/6
R1A_CVHSA Replicase polyprotein 1a
6vww[3] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
3vb4[1] K GOL
GLYCEROL[6 atoms]
B 100.0
/96.1
4
/4
R1A_CVHSA 3C-like proteinase
3vb7[1] H GOL
GLYCEROL[6 atoms]
B 83.3
/96.1
6
/6
R1A_CVHSA 3C-like proteinase
6xa9[3] G GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Papain-like protease
6wrh[2] H GOL
GLYCEROL[6 atoms]
A 100.0
/99.7
3
/3
R1AB_SARS2 Non-structural protein 3
6xbi[1] E GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 main protease
6yt8[2] C IMD
IMIDAZOLE[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
6yz6[2] E IMD
IMIDAZOLE[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Main Protease
6w75[3] O FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6xdh[3] I FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6w75[13] H FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[6] J FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[3] L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[2] DA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
6xkh[5] D FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
6xdh[3] G FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wkq[4] L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6wkq[4] H FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
6xdh[3] F FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] U FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] U FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[6] Q FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
7jfq[2] E FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
6xdh[3] M FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wjt[1] K FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6xdh[6] E FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[3] P FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6w75[5] FA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[3] AA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
6wlc[4] V FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6xkh[2] E FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
6w75[1] KA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
6xkh[2] G FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
6w75[2] CA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
6
/6
R1AB_SARS2 SARS-CoV-2 NSP16
6wjt[1] L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6wjt[1] P FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6xkh[2] F FMT
FORMIC ACID[3 atoms]
A 85.7
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
7jfq[2] C FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
6w4h[1] C SO3
SULFITE ION[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
6wvn[1] Z SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
2v6n[7] D SO4
SULFATE ION[5 atoms]
A 100.0
/96.1
2
/2
R1AB_CVHSA REPLICASE POLYPROTEIN 1AB
2fe8[6] M SO4
SULFATE ION[5 atoms]
B 100.0
/82.7
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
6wq3[5] I SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 10
5wwp[6] L SO4
SULFATE ION[5 atoms]
B 100.0
/72.8
5
/5
K0BWD0_9BETC ORF1ab
6wq3[6] J SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wxd[1] C SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Non-structural protein 9
6vxs[2] I SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
6vxs[2] F SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
2w2g[2] D SO4
SULFATE ION[5 atoms]
B 33.3
/75.0
3
/3
R1A_CVHSA NON-STRUCTURAL PROTEIN 3
6wlc[3] L SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6wrz[3] M SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
5tl6[1] F SO4
SULFATE ION[5 atoms]
A 100.0
/82.9
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
6wvn[3] U SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] Y SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wxd[1] E SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 9
6wrz[4] F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
2ahm[2] N SO4
SULFATE ION[5 atoms]
H 75.0
/97.4
4
/4
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
5wwp[1] J SO4
SULFATE ION[5 atoms]
B 100.0
/72.8
6
/6
K0BWD0_9BETC ORF1ab
5wwp[1] K SO4
SULFATE ION[5 atoms]
B 100.0
/72.8
4
/4
K0BWD0_9BETC ORF1ab
6wrz[1] L SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wlc[3] N TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[6] N TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
5rf2[2] E HVB
1-azanylpropylideneazanium[5 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
3vb4[44] F EDO
1,2-ETHANEDIOL[4 atoms]
A 60.0
/96.0
5
/5
R1A_CVHSA 3C-like proteinase
3vb4[5] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/96.0
2
/2
R1A_CVHSA 3C-like proteinase
3vb3[10] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/96.0
6
/6
R1A_CVHSA 3C-like proteinase
6wks[2] H EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 10
3vb3[1] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/96.0
5
/5
R1A_CVHSA 3C-like proteinase
3vb4[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/96.0
2
/2
R1A_CVHSA 3C-like proteinase
3vb3[6] H EDO
1,2-ETHANEDIOL[4 atoms]
A 83.3
/96.0
6
/6
R1A_CVHSA 3C-like proteinase
6wlc[9] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[49] CA EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6xhn[43] D EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/96.0
5
/5
R1A_CVHSA 3C-like proteinase
3vb4[26] H EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/96.1
5
/5
R1A_CVHSA 3C-like proteinase
6xkh[2] B EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6wlc[29] P EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[6] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6w61[24] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 2'-O-methyltransferase
6ywl[3] R EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 NSP3 macrodomain
6x4i[3] X EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] V EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6ywl[1] U EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
5
/5
R1AB_SARS2 NSP3 macrodomain
6x4i[6] S EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[6] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] L EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[6] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[12] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6x1b[3] H EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[3] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[12] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[3] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
3vb7[3] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/96.0
3
/3
R1A_CVHSA 3C-like proteinase
6xkh[2] C EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
6wlc[6] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
3vb4[1] L EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/96.1
5
/5
R1A_CVHSA 3C-like proteinase
6w01[3] M EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6ywk[2] O EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
4
/5
R1AB_SARS2 NSP3 macrodomain
3vb3[1] I EDO
1,2-ETHANEDIOL[4 atoms]
B 66.7
/96.1
3
/3
R1A_CVHSA 3C-like proteinase
6ywk[1] Z EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
1
/1
R1AB_SARS2 NSP3 macrodomain
6xkf[1] C EDO
1,2-ETHANEDIOL[4 atoms]
A 80.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
6ywk[1] W EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
1
/1
R1AB_SARS2 NSP3 macrodomain
6w01[3] S EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6ywm[1] P EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/98.8
3
/3
R1AB_SARS2 NSP3 macrodomain
6ywk[1] L EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
2
/3
R1AB_SARS2 NSP3 macrodomain
1q2w[1] C MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 80.0
/96.3
5
/5
R1A_CVHSA 3C-like protease
2z9g[2] C BNZ
BENZENE[6 atoms]
A 100.0
/96.1
7
/7
R1AB_CVHSA 3C-like proteinase
2z9k[2] E DOZ
(dimethylamino)(hydroxy)zinc'[5 atoms]
A 100.0
/96.1
5
/5
R1AB_CVHSA 3C-like proteinase
5nfy[2] T PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
C 100.0
/94.7
1
/1
Q1T6X8_CVHSA Polyprotein 1ab
6yvf[2] K PEG
DI(HYDROXYETHYL)ETHER[6 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6yt8[2] E PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
6w01[6] AA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6yvf[2] J PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
6w01[3] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
6yvf[2] I PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
3vb3[2] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/96.0
4
/4
R1A_CVHSA 3C-like proteinase
6yt8[2] F PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Replicase polyprotein 1ab
6wtt[2] E PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
3snd[1] E MRD
(4R)-2-METHYLPENTANE-2,4-DIOL[8 atoms]
A 83.3
/96.1
6
/6
R1A_CVHSA 3C-like proteinase
2v6n[6] C MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 80.0
/96.1
5
/5
R1AB_CVHSA REPLICASE POLYPROTEIN 1AB
6wcf[1] C MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
6w6y[4] D MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
B 100.0
/100.0
11
/11
R1AB_SARS2 SARS-CoV-2 NSP3
6wco[2] C MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/96.1
3
/3
A0A3G5BIY8_CVHSA Main protease
7jir[3] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
7jiw[1] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
6
/6
R1A_SARS2 Papain-Like Protease
2gt7[1] C MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
B 100.0
/96.0
1
/1
R1AB_CVHSA 3C-like proteinase
6yz1[1] D MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 nsp16
2z9j[2] H DTZ
zinc(II)hydrogensulfide[3 atoms]
B 100.0
/96.1
3
/3
R1AB_CVHSA 3C-like proteinase
2z9l[2] E DAZ
diaminozinc[3 atoms]
A 100.0
/96.3
2
/2
R1AB_CVHSA 3C-like proteinase
5y3q[1] C BME
BETA-MERCAPTOETHANOL[4 atoms]
A 100.0
/82.8
6
/6
R1A_CVHSA Replicase polyprotein 1a
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.