[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57115 97 10 P0DTD2(ORF9B_SARS2) RecName: Full=ORF9b protein;AltName: Full=Accessory protein 9b;AltName: Full=ORF-9b;AltName: Full=Protein 9b;
QUERYSEQ
MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTD2(ORF9B_SARS2)]

97
region name description
1-97 CHAIN /note="ORF9b protein" /id="PRO_0000449657"
8-97 DOMAIN /note="9b"
1-4 DISORDER predicted by DISOPRED (1-4)

MONOMER
97
pdb_id a1 identity[%]2 description
6z4u A 100.0 ORF9B_SARS2 Protein 9b
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
97 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2cme[6] B Y5_CVHSA HYPOTHETICAL PROTEIN 5[79 aa] A 84.4
/80.3
32
/32
Y5_CVHSA HYPOTHETICAL PROTEIN 5
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
97 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6z4u[1] C 15P
POLYETHYLENE GLYCOL (N=34)[14 atoms]
B 100.0
/100.0
7
/7
ORF9B_SARS2 Protein 9b
2cme[3] K D10
DECANE[10 atoms]
F 100.0
/81.3
3
/3
Y5_CVHSA HYPOTHETICAL PROTEIN 5
2cme[2] L D10
DECANE[10 atoms]
H 100.0
/81.3
2
/2
Y5_CVHSA HYPOTHETICAL PROTEIN 5
2cme[1] I D10
DECANE[10 atoms]
B 100.0
/80.5
2
/2
Y5_CVHSA HYPOTHETICAL PROTEIN 5
2cme[1] K D10
DECANE[10 atoms]
E 100.0
/81.3
2
/2
Y5_CVHSA HYPOTHETICAL PROTEIN 5
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
97 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6z4u[2] B ORF9B_SARS2 Protein 9b[82 aa] A 100.0
/100.0
33
/33
ORF9B_SARS2 Protein 9b
2cme[2] D Y5_CVHSA HYPOTHETICAL PROTEIN 5[76 aa] C 84.4
/81.3
32
/32
Y5_CVHSA HYPOTHETICAL PROTEIN 5
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.