[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57775 967 323 P15144(AMPN_HUMAN) RecName: Full=Aminopeptidase N {ECO:0000305}; Short=AP-N; Short=hAPN; EC=3.4.11.2 {ECO:0000269|PubMed:22932899, ECO:0000269|PubMed:6149934, ECO:0000269|PubMed:7576235, ECO:0000269|PubMed:8887485};AltName: Full=Alanyl aminopeptidase;AltName: Full=Aminopeptidase M; Short=AP-M;AltName: Full=Microsomal aminopeptidase;AltName: Full=Myeloid plasma membrane glycoprotein CD13;AltName: Full=gp150;AltName: CD_antigen=CD13;
QUERYSEQ
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDI
DKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHPKDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI
RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALA
SSHPLSTPASEINTPAQISELFDAISYSKGASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMNRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY
WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQIINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKNYLKKQVTPLFIHFRNNTNNWREIPENLMDQ
YSEVNAISTACSNGVPECEEMVSGLFKQWMENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWILNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN
LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSK
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P15144(AMPN_HUMAN)]

967
region name description
2-967 CHAIN /note="Aminopeptidase N" /id="PRO_0000095081"
2-8 TOPO_DOM /note="Cytoplasmic"
9-32 TRANSMEM /note="Helical; Signal-anchor for type II membrane protein"
33-967 TOPO_DOM /note="Extracellular"
33-68 REGION /note="Cytosolic Ser/Thr-rich junction"
69-967 REGION /note="Metalloprotease"
288-295 REGION /note="Necessary and sufficient to mediate interaction with HCoV-229E" ECO:0000269|PubMed:8887485"
352-356 REGION /note="Substrate binding"
389-389 ACT_SITE /note="Proton acceptor" ECO:0000269|PubMed:22932899"
388-388 METAL /note="Zinc; catalytic" ECO:0000244|PDB:4FYT, ECO:0000269|PubMed:22932899"
392-392 METAL /note="Zinc; catalytic" ECO:0000244|PDB:4FYT, ECO:0000269|PubMed:22932899"
411-411 METAL /note="Zinc; catalytic" ECO:0000244|PDB:4FYT, ECO:0000269|PubMed:22932899"
1-967 DISORDER predicted by DISOPRED (1-65,140-140,147-147,259-259,603-605,967-967)

MONOMER
967
pdb_id a1 identity[%]2 description
5lhd C 100.0 AMPN_HUMAN Aminopeptidase N
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
967 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6u7e[1] C Spike glycoprotein[109 aa] A 100.0
/100.0
13
/13
AMPN_HUMAN Aminopeptidase N
6u7f[1] D Spike glycoprotein[103 aa] B 100.0
/100.0
13
/13
AMPN_HUMAN Aminopeptidase N
6u7f[1] C Spike glycoprotein[96 aa] A 100.0
/100.0
14
/14
AMPN_HUMAN Aminopeptidase N
4fys[1] B ANGT_HUMAN Angiotensin IV[6 aa] A 100.0
/100.0
21
/21
AMPN_HUMAN Aminopeptidase N
6u7g[2] D H1AG31_CVH22 Spike protein[111 aa] B 100.0
/100.0
14
/14
AMPN_HUMAN Aminopeptidase N
6atk[1] D SPIKE_CVH22 Spike glycoprotein[134 aa] B 100.0
/100.0
11
/11
AMPN_HUMAN Aminopeptidase N
6atk[1] F SPIKE_CVH22 Spike glycoprotein[11 aa] C 100.0
/100.0
9
/9
AMPN_HUMAN Aminopeptidase N
6atk[1] E SPIKE_CVH22 Spike glycoprotein[78 aa] A 100.0
/100.0
11
/11
AMPN_HUMAN Aminopeptidase N
6u7e[1] D Spike glycoprotein[117 aa] B 100.0
/100.0
13
/13
AMPN_HUMAN Aminopeptidase N
4hom[1] B substance P[11 aa] A 87.5
/79.8
32
/32
AMPN_PIG Aminopeptidase N
4ou3[2] B tumor-homing peptide[6 aa] A 93.3
/79.8
15
/15
AMPN_PIG Aminopeptidase N
4nz8[1] B CLEAVED poly-Ala[1 aa] A 100.0
/79.7
6
/6
AMPN_PIG Aminopeptidase N
4nz8[1] C CLEAVED poly-Ala[6 aa] A 78.6
/79.7
14
/14
AMPN_PIG Aminopeptidase N
4f5c[2] D Q84852_9ALPC PRCV spike protein[139 aa] B 58.8
/79.8
17
/17
AMPN_PIG Aminopeptidase N
4naq[1] B poly A peptide[7 aa] A 83.3
/79.6
18
/18
AMPN_PIG Aminopeptidase N
6rqx[1] B PSE-LYS-HIS-HIS-ALA-PHE-SER-PHE-LYS[9 aa] A 34.1
/37.1
44
/44
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6mgq[3] F Phosphinic inhibitor DG014[5 aa] C 44.4
/36.8
18
/18
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ryf[1] B PSE-ARG-ILE-GLN-ARG-ALA-PHE-VAL-THR-ILE[10 aa] A 48.3
/36.9
29
/30
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
4wz9[1] D ALA-ALA-LYS[3 aa] B 84.6
/36.9
13
/13
Q7Q2T8_ANOGA AGAP004809-PA
4wz9[1] C ALA-ALA-ALA-LYS-ALA[5 aa] A 91.7
/36.9
12
/12
Q7Q2T8_ANOGA AGAP004809-PA
4z7i[1] D DG025 transition-state analogue enzyme inhibitor[5.. B 83.3
/36.9
12
/12
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5ab0[2] D DG025[10 aa] B 50.0
/37.2
28
/28
ERAP2_HUMAN ENDOPLASMATIC RETICULUM AMINOPEPTIDASE 2
4z7i[1] C DG025 transition-state analogue enzyme inhibitor[1.. A 52.4
/36.7
21
/21
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5ab2[2] D GPI[6 aa] B 63.2
/37.0
19
/19
ERAP2_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 2
6ifg[2] D Tripeptides (TYR-SER-ALA)[3 aa] B 75.0
/34.4
12
/15
Q9RVZ5_DEIRA Zinc metalloprotease
4fyt[2] B AMASTATIN[4 aa] A 100.0
/100.0
17
/17
AMPN_HUMAN Aminopeptidase N
4kx8[2] B amastatin[4 aa] A 66.7
/37.9
18
/18
AMPE_HUMAN Glutamyl aminopeptidase
6enb[1] B PRO-GLY-PRO[3 aa] A 61.5
/29.8
13
/15
LKHA4_HUMAN Leukotriene A-4 hydrolase
3b7s[1] B RSR peptide[3 aa] A 60.0
/29.8
15
/17
LKHA4_HUMAN Leukotriene A-4 hydrolase
3b7t[1] B RAR peptide[3 aa] A 53.3
/29.8
15
/17
LKHA4_HUMAN Leukotriene A-4 hydrolase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
967 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6bv2[1] M ILE
ISOLEUCINE[9 atoms]
A 100.0
/79.8
10
/10
AMPN_PIG Aminopeptidase N
3b2p[2] E ARG
ARGININE[12 atoms]
A 66.7
/30.3
12
/15
AMPN_ECOLI Aminopeptidase N
6kp0[2] D ARG
ARGININE[12 atoms]
A 77.8
/34.4
9
/11
Q9RVZ5_DEIRA Zinc metalloprotease, putative
4xmv[1] C ARG
ARGININE[12 atoms]
A 75.0
/30.9
12
/15
AMPN_ECOLI Aminopeptidase N
4j3b[1] B ARG
ARGININE[12 atoms]
A 61.5
/29.8
13
/13
AMP1_PLAFQ M1 family aminopeptidase
6bv0[1] M ARG
ARGININE[12 atoms]
A 100.0
/79.8
10
/10
AMPN_PIG Aminopeptidase N
4xn1[1] C GLU
GLUTAMIC ACID[10 atoms]
A 88.9
/30.9
9
/9
AMPN_ECOLI Aminopeptidase N
4kxd[2] L GLU
GLUTAMIC ACID[10 atoms]
A 72.7
/37.9
11
/11
AMPE_HUMAN Glutamyl aminopeptidase
5zi7[2] C GLU
GLUTAMIC ACID[10 atoms]
A 50.0
/26.7
14
/14
Q5ZVE3_LEGPH Aminopeptidase N
4xo5[1] C GLU
GLUTAMIC ACID[10 atoms]
A 72.7
/30.3
11
/13
AMPN_ECOLI Aminopeptidase N
3q7j[1] D FBO
L-phenylalanyl-N6-[(benzyloxy)carbonyl]-N1-hydroxy..
A 58.8
/37.6
17
/17
TRF3_THEAC Tricorn protease-interacting factor F3
4e36[6] G LYS
LYSINE[10 atoms]
A 63.6
/37.1
11
/11
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
4pj6[2] N LYS
LYSINE[9 atoms]
B 87.5
/36.5
8
/8
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
3b2x[1] E LYS
LYSINE[10 atoms]
A 66.7
/30.3
12
/14
AMPN_ECOLI Aminopeptidase N
6ea4[2] T J2G
4-methoxy-3-{[2-(piperidin-1-yl)-4-(trifluoromethy..
B 53.8
/37.2
13
/13
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
5j6s[2] O 6GA
(2S)-N~1~-benzyl-2-[(4-fluorophenyl)methyl]-N~3~-h..
A 69.2
/36.8
13
/13
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
6ydx[1] Q SIN
SUCCINIC ACID[8 atoms]
A 20.0
/37.0
5
/5
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5k1v[1] G 6PX
methyl N-[4-amino-3-(L-arginylamino)benzene-1-carb..
A 63.2
/37.0
19
/19
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
6q4r[1] H B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR..
A 25.0
/36.9
12
/12
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6ryf[1] D B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR..
A 25.0
/36.9
12
/12
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5mj6[2] XA 7O2
[(2~{S})-2-[[(2~{S})-1-azanyl-1-oxidanylidene-3-ph..
B 68.4
/36.9
19
/19
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6q4r[1] G HJ5
[(1~{R})-1-[[(2~{S})-2-[[(2~{S})-1-azaniumyl-1-oxi..
A 75.0
/36.9
16
/16
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
4wz9[1] H NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 14.3
/36.9
7
/7
Q7Q2T8_ANOGA AGAP004809-PA
6m8p[22] OD P52
Nalpha-[(2S)-2-{[[(1R)-1-amino-3-phenylpropyl](hyd..
D 68.4
/36.9
19
/19
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
4jbs[2] Q P52
Nalpha-[(2S)-2-{[[(1R)-1-amino-3-phenylpropyl](hyd..
B 71.4
/37.3
14
/14
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
6ydx[2] J ONN
2-[2-[[[(4~{R},8~{S},11~{S})-11-azanyl-8-[(4-hydro..
A 66.7
/37.0
18
/18
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6m8p[22] PM NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
Q 50.0
/36.9
2
/2
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ydx[9] P NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 20.0
/37.0
5
/5
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5c97[6] X NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/36.5
3
/3
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
4p8q[9] N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/36.7
2
/2
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
4e36[15] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/37.1
1
/1
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
5mj6[15] PA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/36.9
1
/1
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
4jbs[17] O NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/37.3
1
/1
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
5lds[65] W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/79.8
4
/4
AMPN_PIG Aminopeptidase N
5c97[3] U NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/36.5
2
/2
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5lds[11] U NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 80.0
/79.8
5
/5
AMPN_PIG Aminopeptidase N
5z65[15] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/79.8
1
/1
K7GMF9_PIG Aminopeptidase
4e36[12] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/37.1
3
/3
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
5ab2[16] W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/37.0
2
/2
ERAP2_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 2
6u7f[14] N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
AMPN_HUMAN Aminopeptidase N
6u7e[4] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
7
/7
AMPN_HUMAN Aminopeptidase N
4pj6[4] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/36.7
1
/1
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5lds[3] MA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 0.0
/79.8
1
/1
AMPN_PIG Aminopeptidase N
3qnf[2] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 20.0
/37.0
5
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
4hom[7] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/79.8
2
/2
AMPN_PIG Aminopeptidase N
6u7g[7] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
5
/5
AMPN_HUMAN Aminopeptidase N
4fyr[10] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
6
/6
AMPN_HUMAN Aminopeptidase N
4kxb[6] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/37.9
1
/1
AMPE_HUMAN Glutamyl aminopeptidase
6u7f[5] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
5
/5
AMPN_HUMAN Aminopeptidase N
4fyr[3] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
AMPN_HUMAN Aminopeptidase N
4fkh[3] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/79.8
2
/2
AMPN_PIG Aminopeptidase N
4fyr[10] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
5
/5
AMPN_HUMAN Aminopeptidase N
4pj6[1] S NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 25.0
/36.5
4
/4
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
4fyr[6] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
AMPN_HUMAN Aminopeptidase N
4pj6[1] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/36.5
3
/3
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6rqx[1] C NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/37.1
1
/1
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
4ou3[3] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/79.8
2
/2
AMPN_PIG Aminopeptidase N
5ab0[13] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/37.2
3
/3
ERAP2_HUMAN ENDOPLASMATIC RETICULUM AMINOPEPTIDASE 2
6rqx[1] J NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 50.0
/37.1
6
/6
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5mj6[1] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/36.9
2
/2
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[2] T NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/36.9
2
/2
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6atk[1] M NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
AMPN_HUMAN Aminopeptidase N
6atk[1] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
AMPN_HUMAN Aminopeptidase N
6ryf[2] IA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 0.0
/36.9
1
/1
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5mj6[4] RA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/36.9
3
/3
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5lds[7] IA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 33.3
/79.8
3
/3
AMPN_PIG Aminopeptidase N
6ryf[1] EA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 40.0
/36.9
5
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
4kx7[6] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/37.9
3
/3
AMPE_HUMAN Glutamyl aminopeptidase
5lhd[3] EC NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/100.0
2
/2
AMPN_HUMAN Aminopeptidase N
4pj6[4] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/36.7
3
/3
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6ydx[4] Z NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/36.9
1
/1
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5c97[5] W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 66.7
/36.5
3
/3
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
3mdj[1] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/36.8
1
/1
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
4naq[1] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 66.7
/79.6
3
/3
AMPN_PIG Aminopeptidase N
6ydx[2] O NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/37.0
2
/2
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6rqx[1] F NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 20.0
/37.1
5
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ryf[1] JA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/36.9
1
/1
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
4pj6[2] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 28.6
/36.7
7
/7
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[1] VA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 50.0
/36.9
2
/2
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6q4r[1] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/36.9
2
/2
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
4f5c[3] CA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 50.0
/79.8
2
/2
AMPN_PIG Aminopeptidase N
4kx7[1] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/37.9
2
/2
AMPE_HUMAN Glutamyl aminopeptidase
4kx8[2] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/37.9
4
/4
AMPE_HUMAN Glutamyl aminopeptidase
4f5c[2] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/79.7
1
/1
AMPN_PIG Aminopeptidase N
5c97[1] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/36.6
2
/2
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5ab0[1] O NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/36.8
2
/3
ERAP2_HUMAN ENDOPLASMATIC RETICULUM AMINOPEPTIDASE 2
6t6r[1] W MNZ
(4~{a}~{R},5~{S},6~{R},8~{S},8~{a}~{R})-5-[2-(fura..
A 18.2
/36.5
11
/12
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6t6r[1] C MLT
D-MALATE[9 atoms]
A 88.9
/36.5
9
/9
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6q4r[1] MA MLT
D-MALATE[9 atoms]
A 20.0
/36.9
5
/5
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6t6r[1] D MLT
D-MALATE[9 atoms]
A 28.6
/36.5
7
/7
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
3b37[1] E TYR
TYROSINE[13 atoms]
A 72.7
/30.3
11
/13
AMPN_ECOLI Aminopeptidase N
6iff[4] G TYR
TYROSINE[13 atoms]
B 77.8
/34.4
9
/11
Q9RVZ5_DEIRA Zinc metalloprotease
4xo4[1] E MET
METHIONINE[9 atoms]
A 72.7
/30.3
11
/13
AMPN_ECOLI Aminopeptidase N
4xn4[1] C MET
METHIONINE[9 atoms]
A 81.8
/30.9
11
/13
AMPN_ECOLI Aminopeptidase N
4xn4[1] F MET
METHIONINE[9 atoms]
A 0.0
/30.9
1
/8
AMPN_ECOLI Aminopeptidase N
6kp1[2] E MET
METHIONINE[9 atoms]
A 85.7
/34.7
7
/9
Q9RVZ5_DEIRA Zinc metalloprotease, putative
6bv4[1] M MET
METHIONINE[9 atoms]
A 100.0
/79.8
10
/10
AMPN_PIG Aminopeptidase N
4xo3[2] C LEU
LEUCINE[9 atoms]
A 72.7
/30.3
11
/13
AMPN_ECOLI Aminopeptidase N
6bv3[1] M LEU
LEUCINE[9 atoms]
A 100.0
/79.8
9
/9
AMPN_PIG Aminopeptidase N
6koz[2] G LEU
LEUCINE[9 atoms]
B 100.0
/34.7
6
/7
Q9RVZ5_DEIRA Zinc metalloprotease, putative
2xpz[1] D 15P
POLYETHYLENE GLYCOL (N=34)[15 atoms]
A 10.0
/31.1
10
/10
LKHA4_YEAST LEUKOTRIENE A-4 HYDROLASE
3b34[1] E PHE
PHENYLALANINE[12 atoms]
A 75.0
/30.3
12
/14
AMPN_ECOLI Aminopeptidase N
4xn5[1] C PHE
PHENYLALANINE[12 atoms]
A 90.0
/30.9
10
/12
AMPN_ECOLI Aminopeptidase N
4xn7[2] C DPP
DIAMINOPROPANOIC ACID[7 atoms]
A 80.0
/30.3
10
/11
AMPN_ECOLI Aminopeptidase N
5yq1[2] C 0A1
O-methyl-L-tyrosine[14 atoms]
A 72.7
/30.3
11
/14
AMPN_ECOLI Aminopeptidase N
2yd0[1] I BES
2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METH..
A 80.0
/37.5
15
/15
ERAP1_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 1
2xq0[1] B BES
2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METH..
A 66.7
/31.9
12
/12
LKHA4_YEAST LEUKOTRIENE A-4 HYDROLASE
4fyr[2] L BES
2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METH..
A 100.0
/100.0
15
/15
AMPN_HUMAN Aminopeptidase N
3fuf[6] G BES
2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METH..
A 68.8
/30.1
16
/17
LKHA4_HUMAN Leukotriene A-4 hydrolase
4xmx[1] C BES
2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METH..
A 73.3
/30.9
15
/17
AMPN_ECOLI Aminopeptidase N
3mdj[5] O BES
2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METH..
C 75.0
/36.8
12
/12
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
4gaa[3] F BES
2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METH..
B 85.7
/32.1
14
/15
Q6IP81_XENLA MGC78867 protein
4fkk[1] M BES
2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METH..
A 100.0
/79.8
13
/13
AMPN_PIG Aminopeptidase N
2dqm[1] E BES
2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METH..
A 71.4
/30.3
14
/16
AMPN_ECOLI Aminopeptidase N
5mfr[1] C 7MK
[(7~{S})-6,6-bis(oxidanyl)-5,7,8,9-tetrahydrobenzo..
A 72.7
/30.3
11
/13
AMPN_ECOLI Aminopeptidase N
5mft[2] C 7MF
[(7~{S})-1-bromanyl-6,6-bis(oxidanyl)-4-phenyl-5,7..
A 69.2
/30.3
13
/14
AMPN_ECOLI Aminopeptidase N
4xna[1] C B3K
(3S)-3,7-DIAMINOHEPTANOIC ACID[11 atoms]
A 66.7
/30.3
12
/14
AMPN_ECOLI Aminopeptidase N
6koy[2] C TRP
TRYPTOPHAN[15 atoms]
A 77.8
/34.4
9
/12
Q9RVZ5_DEIRA Zinc metalloprotease
3b3b[1] E TRP
TRYPTOPHAN[15 atoms]
A 69.2
/30.3
13
/17
AMPN_ECOLI Aminopeptidase N
3qjx[1] F SER
SERINE[7 atoms]
A 72.7
/30.3
11
/12
AMPN_ECOLI Aminopeptidase N
4xnb[1] C 3FB
(3S)-3-AMINO-4-PHENYLBUTANOIC ACID[13 atoms]
A 75.0
/30.3
12
/14
AMPN_ECOLI Aminopeptidase N
5y1x[1] D BB2
ACTINONIN[27 atoms]
A 90.9
/29.8
11
/13
AMP1_PLAFQ M1 family aminopeptidase
4q4e[1] C BB2
ACTINONIN[27 atoms]
A 69.2
/30.3
13
/15
AMPN_ECOLI Aminopeptidase N
5yqb[2] D GMC
(2R,3R,4S,5S)-4-AMINO-2-[6-(DIMETHYLAMINO)-9H-PURI..
A 44.4
/30.3
9
/10
AMPN_ECOLI Aminopeptidase N
4xnd[1] C HT7
(3S)-3-AMINO-4-(1H-INDOL-3-YL)BUTANOIC ACID[16 ato..
A 66.7
/30.3
12
/14
AMPN_ECOLI Aminopeptidase N
4xmz[1] K DAB
2,4-DIAMINOBUTYRIC ACID[8 atoms]
A 81.8
/30.9
11
/12
AMPN_ECOLI Aminopeptidase N
3ked[1] C DAB
2,4-DIAMINOBUTYRIC ACID[8 atoms]
A 80.0
/30.3
10
/11
AMPN_ECOLI Aminopeptidase N
3ked[1] P MLA
MALONIC ACID[7 atoms]
A 60.0
/30.3
5
/5
AMPN_ECOLI Aminopeptidase N
2zxg[1] C S23
N-{(2S)-3-[(1R)-1-aminoethyl](hydroxy)phosphoryl-2..
A 73.3
/30.3
15
/17
AMPN_ECOLI Aminopeptidase N
6end[1] H BGK
4-([1,3]thiazolo[4,5-b]pyridin-2-yloxy)benzaldehyd..
A 25.0
/30.1
12
/12
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fu3[1] D 92G
4-(2-amino-1,3-thiazol-4-yl)phenol[13 atoms]
A 33.3
/30.1
3
/8
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fu3[1] E 92G
4-(2-amino-1,3-thiazol-4-yl)phenol[13 atoms]
A 16.7
/30.1
12
/12
LKHA4_HUMAN Leukotriene A-4 hydrolase
6enc[1] H BGW
1-[[4-(1,3-benzothiazol-2-yloxy)phenyl]methyl]pipe..
A 52.4
/30.1
21
/21
LKHA4_HUMAN Leukotriene A-4 hydrolase
2r59[1] D PH0
N-{(2S)-3-[(R)-[(1R)-1-amino-2-phenylethyl](hydrox..
A 63.2
/30.1
19
/21
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fu5[1] D 492
1-(2,2'-bithiophen-5-yl)methanamine[12 atoms]
A 50.0
/30.1
12
/12
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fud[1] D 692
N-methyl-1-(2-thiophen-2-ylphenyl)methanamine[14 a..
A 25.0
/30.1
4
/9
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fuh[1] F 5H1
1H-indol-5-ol[10 atoms]
A 25.0
/30.1
8
/8
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fui[1] F 812
N-benzyl-4-[(2R)-pyrrolidin-2-ylmethoxy]aniline[21..
A 33.3
/30.1
15
/15
LKHA4_HUMAN Leukotriene A-4 hydrolase
4mkt[2] C 28T
1-{4-oxo-4-[(2S)-pyrrolidin-2-yl]butanoyl}-L-proli..
A 75.0
/30.1
12
/14
LKHA4_HUMAN Leukotriene A-4 hydrolase
4l2l[2] C 1V6
4-(4-benzylphenyl)-1,3-thiazol-2-amine[19 atoms]
A 18.8
/30.1
16
/16
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fuk[1] D 58Z
1-[2-(1H-indol-5-yloxy)ethyl]piperidine-4-carboxyl..
A 66.7
/30.1
15
/15
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fun[1] D 798
{4-[(2R)-pyrrolidin-2-ylmethoxy]phenyl}(4-thiophen..
A 30.0
/30.1
20
/20
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fh5[1] H 24P
(2R)-2-[(4-benzylphenoxy)methyl]pyrrolidine[20 ato..
A 37.5
/30.1
16
/16
LKHA4_HUMAN Leukotriene A-4 hydrolase
5bpp[1] G A4Z
2-(4-butoxyphenyl)-N-hydroxyacetamide[16 atoms]
A 62.5
/30.1
16
/16
LKHA4_HUMAN Leukotriene A-4 hydrolase
3ful[1] D 52D
pyridin-4-yl[4-(2-pyrrolidin-1-ylethoxy)phenyl]met..
A 37.5
/30.1
16
/16
LKHA4_HUMAN Leukotriene A-4 hydrolase
4rsy[1] B B3N
4-(dimethylamino)-N-[7-(hydroxyamino)-7-oxoheptyl]..
A 55.6
/30.1
18
/18
LKHA4_HUMAN Leukotriene A-4 hydrolase
4r7l[1] J SHH
OCTANEDIOIC ACID HYDROXYAMIDE PHENYLAMIDE[19 atoms..
A 60.0
/30.1
15
/15
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fh7[1] H 25P
4-[(2S)-2-{[4-(4-chlorophenoxy)phenoxy]methyl}pyrr..
A 52.4
/30.1
21
/21
LKHA4_HUMAN Leukotriene A-4 hydrolase
3ftz[1] D 848
2-(pyridin-3-ylmethoxy)aniline[15 atoms]
A 30.0
/30.1
10
/10
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fh8[1] H 27P
1-[2-(4-benzylphenoxy)ethyl]pyrrolidine[21 atoms]
A 40.0
/30.1
15
/15
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fue[1] F 11S
5-chloro-1H-indole[10 atoms]
A 14.3
/30.1
7
/7
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fu0[1] E 22F
(4-fluorophenyl)(pyridin-4-yl)methanone[15 atoms]
A 25.0
/30.1
12
/12
LKHA4_HUMAN Leukotriene A-4 hydrolase
3ftv[2] E 11X
N-(pyridin-3-ylmethyl)aniline[14 atoms]
A 25.0
/30.1
12
/12
LKHA4_HUMAN Leukotriene A-4 hydrolase
6o5h[3] H LNJ
4-{4-[(4-methoxyphenyl)methyl]phenyl}-1,3-thiazol-..
C 26.7
/30.1
15
/15
LKHA4_HUMAN Leukotriene A-4 hydrolase
3chr[1] D 4BS
4-amino-N-[4-(benzyloxy)phenyl]butanamide[21 atoms..
A 41.2
/30.1
17
/17
LKHA4_HUMAN Leukotriene A-4 hydrolase
3chs[1] G 4BU
(2S)-2-amino-5-[[4-[(2S)-2-hydroxy-2-phenyl-ethoxy..
A 50.0
/30.1
20
/20
LKHA4_HUMAN Leukotriene A-4 hydrolase
3chp[1] F 4BO
(3S)-3-amino-4-oxo-4-[(4-phenylmethoxyphenyl)amino..
A 44.4
/30.1
18
/18
LKHA4_HUMAN Leukotriene A-4 hydrolase
2vj8[1] G HA2
6-[{(2S)-2-AMINO-3-[4-(BENZYLOXY)PHENYL]PROPYL}(HY..
A 66.7
/30.1
18
/20
Q6IAT6_HUMAN LTA4H PROTEIN
3cho[1] E 4BG
N-[4-(benzyloxy)phenyl]glycinamide[19 atoms]
A 40.0
/30.1
15
/15
LKHA4_HUMAN Leukotriene A-4 hydrolase
3b7u[1] G KEL
N-[(2R)-2-benzyl-4-(hydroxyamino)-4-oxobutanoyl]-L..
A 66.7
/30.1
12
/14
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fhe[1] H 28P
N-[3-(4-benzylphenoxy)propyl]-N-methyl-beta-alanin..
A 55.0
/30.1
20
/20
LKHA4_HUMAN Leukotriene A-4 hydrolase
3u9w[1] I 28P
N-[3-(4-benzylphenoxy)propyl]-N-methyl-beta-alanin..
A 57.9
/30.1
19
/19
LKHA4_HUMAN Leukotriene A-4 hydrolase
3ftu[2] D RE2
5-[2-(4-hydroxyphenyl)ethyl]benzene-1,3-diol[17 at..
A 21.4
/30.1
14
/14
LKHA4_HUMAN Leukotriene A-4 hydrolase
5n3w[1] E 8KW
3-[2-(2-hydroxyphenyl)ethyl]-5-methoxy-phenol[18 a..
A 25.0
/30.1
12
/12
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fum[1] D 80A
(R)-pyridin-4-yl[4-(2-pyrrolidin-1-ylethoxy)phenyl..
A 40.0
/30.1
15
/15
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fu6[1] D 80G
1-(4-thiophen-2-ylphenyl)methanamine[13 atoms]
A 27.3
/30.1
11
/11
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fuj[1] D 00G
5-[2-(1H-pyrrol-1-yl)ethoxy]-1H-indole[17 atoms]
A 46.2
/30.1
13
/13
LKHA4_HUMAN Leukotriene A-4 hydrolase
3chq[1] G 4BQ
(2S)-2-amino-5-oxo-5-[(4-phenylmethoxyphenyl)amino..
A 52.6
/30.1
19
/19
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fuf[1] F 14O
5-fluoro-1H-indole[10 atoms]
A 14.3
/30.1
7
/7
LKHA4_HUMAN Leukotriene A-4 hydrolase
3b7r[1] E BIR
N-[3-[(1-AMINOETHYL)(HYDROXY)PHOSPHORYL]-2-(1,1'-B..
A 71.4
/30.1
14
/16
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fts[1] D STL
RESVERATROL[17 atoms]
A 20.0
/30.1
15
/15
LKHA4_HUMAN Leukotriene A-4 hydrolase
4dpr[1] C X8Z
L-CAPTOPRIL[14 atoms]
A 62.5
/30.1
8
/10
LKHA4_HUMAN Leukotriene A-4 hydrolase
3fty[1] D 3IP
3-(BENZYLOXY)PYRIDIN-2-AMINE[15 atoms]
A 30.0
/30.1
10
/10
LKHA4_HUMAN Leukotriene A-4 hydrolase
5aen[1] B DP8
N,N-dimethyl-2-(4-phenoxyphenoxy)ethanamine[19 ato..
A 35.7
/30.1
14
/14
LKHA4_HUMAN LEUKOTRIENE A-4 HYDROLASE
5ni4[5] M DJ3
5S-5,6-oxido-7,9-trans-11,14-cis-eicosatetraenoic ..
B 60.0
/29.8
15
/17
LKHA4_HUMAN Leukotriene A-4 hydrolase
5yo1[2] D PUY
PUROMYCIN[34 atoms]
A 25.0
/29.8
8
/8
AMPN_ECOLI Aminopeptidase N
5y3i[1] F 8N3
(2R)-4-methyl-2-[(3-methylphenyl)methylcarbamoylam..
A 62.5
/29.8
16
/16
AMP1_PLAFQ M1 family aminopeptidase
5mfs[1] C 7ML
[(7~{S})-6,6-bis(oxidanyl)-4-phenyl-5,7,8,9-tetrah..
A 69.2
/30.3
13
/15
AMPN_ECOLI Aminopeptidase N
6sbq[1] C 7ML
[(7~{S})-6,6-bis(oxidanyl)-4-phenyl-5,7,8,9-tetrah..
A 69.2
/29.8
13
/13
Q8IEK1_PLAF7 M1-family alanyl aminopeptidase
5y19[1] F 8KO
(2S)-2-[[(2S,3R)-3-azanyl-2-oxidanyl-4-phenyl-buta..
A 76.5
/29.8
17
/17
AMP1_PLAFQ M1 family aminopeptidase
5y1r[1] G 8KR
(2R)-4-methyl-2-[(2-methylphenyl)carbamoylamino]-N..
A 76.9
/29.8
13
/13
AMP1_PLAFQ M1 family aminopeptidase
5y1k[1] L B1B
(2S)-2-[(2-chlorophenyl)methylcarbamoylamino]-4-me..
A 71.4
/29.8
14
/15
AMP1_PLAFQ M1 family aminopeptidase
5y1q[1] F 8L0
(2S)-2-[(3-chlorophenyl)methylcarbamoylamino]-4-me..
A 76.9
/29.8
13
/15
AMP1_PLAFQ M1 family aminopeptidase
5y1t[1] F E8G
(2S)-2-[(2,3-dimethylphenyl)methylcarbamoylamino]-..
A 73.3
/29.8
15
/16
AMP1_PLAFQ M1 family aminopeptidase
5y1h[1] I E8C
(2R)-2-[[2,4-bis(fluoranyl)phenyl]methylcarbamoyla..
A 78.6
/29.8
14
/16
AMP1_PLAFQ M1 family aminopeptidase
5xm7[1] Q 89X
(2S)-4-methyl-N-[(1R)-2-(oxidanylamino)-2-oxidanyl..
A 61.5
/29.8
13
/13
AMP1_PLAFQ M1 family aminopeptidase
5y1s[1] F E8F
(2S)-2-[(3,4-dimethylphenyl)methylcarbamoylamino]-..
A 71.4
/29.8
14
/15
AMP1_PLAFQ M1 family aminopeptidase
5y1v[1] E 8LO
(2R)-2-[(2,6-diethylphenyl)carbamoylamino]-4-methy..
A 76.9
/29.8
13
/13
AMP1_PLAFQ M1 family aminopeptidase
6sbr[1] C L5E
[(7~{S})-1,4-bis(bromanyl)-6,6-bis(oxidanyl)-5,7,8..
A 66.7
/29.8
12
/12
Q8IEK1_PLAF7 M1-family alanyl aminopeptidase
4qpe[1] B 37E
[(1R)-1-amino-2-(cyclohexylamino)ethyl]phosphonic ..
A 63.6
/28.9
11
/16
Q9JYV4_NEIMB Aminopeptidase N
4qme[1] B 37B
(2S)-3-[(S)-[(1R)-1-amino-3-phenylpropyl](hydroxy)..
A 62.5
/28.9
16
/20
Q9JYV4_NEIMB Aminopeptidase N
5dyf[1] M 5HR
[(1R)-1-amino-2-(benzylamino)ethyl]phosphonic acid..
A 63.6
/28.9
11
/16
Q9JYV4_NEIMB Aminopeptidase N
4pw4[1] B 2X0
[(1R)-1-amino-3-phenylpropyl]phosphonic acid[14 at..
A 63.6
/28.9
11
/14
Q9JYV4_NEIMB Aminopeptidase N
4qir[1] B 379
3-{[(R)-1-amino-3-(pyridin-3-yl)propyl](hydroxy)ph..
A 60.0
/28.9
15
/18
Q9JYV4_NEIMB Aminopeptidase N
4quo[1] I 3DZ
(2S)-2-[3-(aminomethyl)benzyl]-3-[(R)-[(1R)-1-amin..
A 0.0
/28.9
1
/11
E6MUM9_NEIMH Aminopeptidase N
4quo[1] B 3DZ
(2S)-2-[3-(aminomethyl)benzyl]-3-[(R)-[(1R)-1-amin..
A 64.3
/28.9
14
/19
E6MUM9_NEIMH Aminopeptidase N
4pvb[1] B 2WW
[(1S)-1-amino-3-methylbutyl]phosphonic acid[10 ato..
A 63.6
/28.9
11
/13
Q9JYV4_NEIMB Aminopeptidase N
4pu2[1] B PLU
LEUCINE PHOSPHONIC ACID[10 atoms]
A 63.6
/28.9
11
/13
Q9JYV4_NEIMB Aminopeptidase N
4qhp[1] B 32Q
(2S)-2-[4-(aminomethyl)benzyl]-3-[(R)-[(1R)-1-amin..
A 62.5
/28.9
16
/20
Q9JYV4_NEIMB Aminopeptidase N
4k5m[1] G 1OV
[(1R)-1-amino-4-carbamimidamidobutyl]phosphonic ac..
A 72.7
/28.5
11
/11
AMP1_PLAFQ M1 family aminopeptidase
4k5n[1] G 1OU
[(R)-amino(4-carbamimidamidophenyl)methyl]phosphon..
A 64.3
/28.5
14
/15
AMP1_PLAFQ M1 family aminopeptidase
4k5o[1] G 1OT
{(R)-amino[4-(1H-pyrazol-1-yl)phenyl]methyl}phosph..
A 69.2
/28.5
13
/14
AMP1_PLAFQ M1 family aminopeptidase
4k5p[1] G 1OS
[(R)-amino(4-carbamimidoylphenyl)methyl]phosphonic..
A 69.2
/28.5
13
/14
AMP1_PLAFQ M1 family aminopeptidase
6eab[1] C J2D
N-[(1R)-2-(hydroxyamino)-2-oxo-1-(3',4',5'-trifluo..
A 68.4
/28.5
19
/20
AMP1_PLAFQ M1 family aminopeptidase
3q44[1] C D50
N-{(2S,3R)-3-amino-4-[4-(benzyloxy)phenyl]-2-hydro..
A 68.4
/28.5
19
/21
AMP1_PLAFQ M1 family aminopeptidase
3q43[1] K D66
N-[(2S,3R)-3-amino-2-hydroxy-4-(4-methoxyphenyl)bu..
A 72.2
/28.5
18
/18
AMP1_PLAFQ M1 family aminopeptidase
4zx4[1] B 4TL
N-[(1R)-2-(hydroxyamino)-2-oxo-1-(3',4',5'-trifluo..
A 66.7
/28.5
18
/19
AMP1_PLAFQ M1 family aminopeptidase
6ea1[1] C J0Y
(2R)-2,3,3,3-tetrafluoro-N-[(1R)-2-(hydroxyamino)-..
A 68.4
/28.5
19
/20
AMP1_PLAFQ M1 family aminopeptidase
3ebi[1] C BEY
(2S)-3-[(R)-[(1S)-1-amino-3-phenylpropyl](hydroxy)..
A 73.7
/28.5
19
/20
AMP1_PLAFQ M1 family aminopeptidase
4zw5[1] C 4SA
tert-butyl [(1S)-1-(biphenyl-4-yl)-2-(hydroxyamino..
A 73.3
/28.5
15
/16
AMP1_PLAFQ M1 family aminopeptidase
4k5l[1] C 19N
[(1R)-1-amino-5-carbamimidamidopentyl]phosphonic a..
A 66.7
/28.5
12
/12
AMP1_PLAFQ M1 family aminopeptidase
4zqt[1] B 4QP
(2R)-2-{[(R)-[(R)-amino(phenyl)methyl](hydroxy)pho..
A 73.3
/28.5
15
/15
AMP1_PLAFQ M1 family aminopeptidase
3t8v[1] F BTJ
N-[(2-{2-[(N-{(2S,3R)-3-amino-4-[4-(benzyloxy)phen..
A 70.6
/28.5
17
/19
AMP1_PLAFQ M1 family aminopeptidase
4zx3[1] C 4TK
N-[(1R)-1-(4-bromophenyl)-2-(hydroxyamino)-2-oxoet..
A 75.0
/28.5
12
/12
AMP1_PLAFQ M1 family aminopeptidase
4zx5[1] C 4TM
N-{(1R)-2-(hydroxyamino)-2-oxo-1-[4-(thiophen-3-yl..
A 71.4
/28.5
14
/15
AMP1_PLAFQ M1 family aminopeptidase
4zw3[1] B 4S9
tert-butyl [(1S)-1-(4-bromophenyl)-2-(hydroxyamino..
A 76.9
/28.5
13
/13
AMP1_PLAFQ M1 family aminopeptidase
6ea2[1] C J1G
N-[(1R)-2-(hydroxyamino)-2-oxo-1-(3',4',5'-trifluo..
A 66.7
/28.5
18
/19
AMP1_PLAFQ M1 family aminopeptidase
6eaa[1] C J1V
N-[(1R)-2-(hydroxyamino)-2-oxo-1-(3',4',5'-trifluo..
A 68.4
/28.5
19
/20
AMP1_PLAFQ M1 family aminopeptidase
4zw8[1] C 4T2
tert-butyl {(1S)-2-(hydroxyamino)-1-[3'-(N'-hydrox..
A 76.5
/28.5
17
/18
AMP1_PLAFQ M1 family aminopeptidase
4zw7[1] C 4SZ
tert-butyl [(1S)-2-(hydroxyamino)-2-oxo-1-(3',4',5..
A 66.7
/28.5
18
/19
AMP1_PLAFQ M1 family aminopeptidase
4zw6[1] B 4SY
tert-butyl {(1S)-2-(hydroxyamino)-1-[4-(1-methyl-1..
A 75.0
/28.5
16
/17
AMP1_PLAFQ M1 family aminopeptidase
6eed[1] C J6A
(2R)-2-[(cyclohexylacetyl)amino]-N-hydroxy-2-(3',4..
A 61.1
/28.5
18
/19
AMP1_PLAFQ M1 family aminopeptidase
4x2u[1] C TOD
(2S)-({(2R)-2-[(1S)-1-hydroxy-2-(hydroxyamino)-2-o..
A 91.7
/28.5
12
/14
AMP1_PLAFQ M1 family aminopeptidase
4zx6[1] C 4U6
N-{(1R)-2-(hydroxyamino)-1-[3'-(N'-hydroxycarbamim..
A 71.4
/28.5
14
/15
AMP1_PLAFQ M1 family aminopeptidase
4r5x[1] H R5X
3-amino-N-{(1R)-2-(hydroxyamino)-2-oxo-1-[4-(1H-py..
A 73.3
/28.5
15
/16
AMP1_PLAFQ M1 family aminopeptidase
4r5v[1] C R5V
N-{(1R)-2-(hydroxyamino)-2-oxo-1-[4-(1H-pyrazol-1-..
A 76.9
/28.5
13
/14
AMP1_PLAFQ M1 family aminopeptidase
4r5t[1] M R5T
tert-butyl {(1S)-2-(hydroxyamino)-2-oxo-1-[4-(1H-p..
A 73.3
/28.5
15
/16
AMP1_PLAFQ M1 family aminopeptidase
6ee3[1] C J4V
(1R,2r,3S,5R,7R)-N-[(1R)-2-(hydroxyamino)-2-oxo-1-..
A 68.4
/28.5
19
/20
AMP1_PLAFQ M1 family aminopeptidase
6ee6[1] C J4P
(2R)-2-[(cyclopentylacetyl)amino]-N-hydroxy-2-(3',..
A 70.0
/28.5
20
/21
AMP1_PLAFQ M1 family aminopeptidase
6ee4[1] C J4S
(2R)-2-[(cyclopropylacetyl)amino]-N-hydroxy-2-(3',..
A 66.7
/28.5
18
/19
AMP1_PLAFQ M1 family aminopeptidase
6bv1[1] M ASP
ASPARTIC ACID[9 atoms]
A 100.0
/79.8
9
/9
AMPN_PIG Aminopeptidase N
4kxa[1] L ASP
ASPARTIC ACID[9 atoms]
A 62.5
/37.9
8
/8
AMPE_HUMAN Glutamyl aminopeptidase
4xmw[1] C ASP
ASPARTIC ACID[9 atoms]
A 88.9
/30.9
9
/9
AMPN_ECOLI Aminopeptidase N
5zie[2] D ASP
ASPARTIC ACID[9 atoms]
B 50.0
/26.7
14
/14
Q5ZVE3_LEGPH Aminopeptidase N
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
967 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4kxa[2] H CA
CALCIUM ION[1 atoms]
A 0.0
/37.9
2
/2
AMPE_HUMAN Glutamyl aminopeptidase
2yd0[1] G K
POTASSIUM ION[1 atoms]
A 0.0
/37.5
2
/2
ERAP1_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 1
2yd0[1] F K
POTASSIUM ION[1 atoms]
A 100.0
/37.5
2
/2
ERAP1_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 1
5mj6[2] Y BR
BROMIDE ION[1 atoms]
A 0.0
/36.9
3
/3
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[1] CB BR
BROMIDE ION[1 atoms]
B 0.0
/36.9
2
/2
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[1] MA BR
BROMIDE ION[1 atoms]
A 0.0
/36.9
1
/1
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[1] BA BR
BROMIDE ION[1 atoms]
A 0.0
/36.9
1
/1
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[3] NA BR
BROMIDE ION[1 atoms]
B 0.0
/36.9
1
/1
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[1] Z BR
BROMIDE ION[1 atoms]
A 33.3
/36.9
3
/4
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[1] EA BR
BROMIDE ION[1 atoms]
A 0.0
/36.9
1
/1
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[1] HA BR
BROMIDE ION[1 atoms]
A 50.0
/36.9
2
/2
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[1] IA BR
BROMIDE ION[1 atoms]
A 25.0
/36.9
4
/4
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[1] FA BR
BROMIDE ION[1 atoms]
A 66.7
/36.9
3
/5
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[1] CA BR
BROMIDE ION[1 atoms]
A 0.0
/36.9
1
/1
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[1] BB BR
BROMIDE ION[1 atoms]
B 100.0
/36.9
1
/1
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
4wz9[1] M CU
COPPER (II) ION[1 atoms]
B 33.3
/36.9
3
/3
Q7Q2T8_ANOGA AGAP004809-PA
4xn1[26] L NA
SODIUM ION[1 atoms]
A 75.0
/30.9
4
/6
AMPN_ECOLI Aminopeptidase N
4q4i[11] D NA
SODIUM ION[1 atoms]
A 50.0
/30.3
2
/4
AMPN_ECOLI Aminopeptidase N
4xo3[18] D NA
SODIUM ION[1 atoms]
A 50.0
/30.3
2
/4
AMPN_ECOLI Aminopeptidase N
6q4r[1] RA NA
SODIUM ION[1 atoms]
A 50.0
/36.9
4
/4
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
4xn1[2] I NA
SODIUM ION[1 atoms]
A 0.0
/30.9
1
/3
AMPN_ECOLI Aminopeptidase N
4xn8[6] N NA
SODIUM ION[1 atoms]
A 0.0
/30.3
1
/1
AMPN_ECOLI Aminopeptidase N
5mft[1] I NA
SODIUM ION[1 atoms]
A 0.0
/30.3
2
/2
AMPN_ECOLI Aminopeptidase N
4xmz[1] I NA
SODIUM ION[1 atoms]
A 0.0
/30.9
1
/4
AMPN_ECOLI Aminopeptidase N
6ryf[1] CA NA
SODIUM ION[1 atoms]
A 20.0
/36.9
5
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
4xo4[1] H NA
SODIUM ION[1 atoms]
A 75.0
/30.3
4
/6
AMPN_ECOLI Aminopeptidase N
4xo4[1] J NA
SODIUM ION[1 atoms]
A 0.0
/30.3
4
/4
AMPN_ECOLI Aminopeptidase N
4xn7[4] F NA
SODIUM ION[1 atoms]
A 50.0
/30.3
2
/4
AMPN_ECOLI Aminopeptidase N
4xnd[4] G NA
SODIUM ION[1 atoms]
A 33.3
/30.3
3
/3
AMPN_ECOLI Aminopeptidase N
5dll[1] R NA
SODIUM ION[1 atoms]
A 0.0
/30.3
1
/7
Q5NE65_FRATT Aminopeptidase N
4xn8[4] R NA
SODIUM ION[1 atoms]
A 0.0
/30.3
3
/3
AMPN_ECOLI Aminopeptidase N
6ryf[2] AA NA
SODIUM ION[1 atoms]
A 71.4
/36.9
7
/7
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
4xo5[2] K NA
SODIUM ION[1 atoms]
A 0.0
/30.3
1
/4
AMPN_ECOLI Aminopeptidase N
4xn1[3] F NA
SODIUM ION[1 atoms]
A 50.0
/30.9
2
/5
AMPN_ECOLI Aminopeptidase N
4xmz[3] J NA
SODIUM ION[1 atoms]
A 0.0
/30.9
1
/7
AMPN_ECOLI Aminopeptidase N
6rqx[1] XA NA
SODIUM ION[1 atoms]
A 66.7
/37.1
3
/3
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] WA NA
SODIUM ION[1 atoms]
A 0.0
/37.1
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] VA NA
SODIUM ION[1 atoms]
A 100.0
/37.1
5
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
3b37[1] C NA
SODIUM ION[1 atoms]
A 40.0
/30.3
5
/5
AMPN_ECOLI Aminopeptidase N
4xn1[1] K NA
SODIUM ION[1 atoms]
A 0.0
/30.9
1
/1
AMPN_ECOLI Aminopeptidase N
4xo4[1] I NA
SODIUM ION[1 atoms]
A 0.0
/30.3
1
/4
AMPN_ECOLI Aminopeptidase N
4xnd[1] F NA
SODIUM ION[1 atoms]
A 0.0
/30.3
2
/2
AMPN_ECOLI Aminopeptidase N
4xo4[1] F NA
SODIUM ION[1 atoms]
A 50.0
/30.3
2
/4
AMPN_ECOLI Aminopeptidase N
4xn4[1] H NA
SODIUM ION[1 atoms]
A 0.0
/30.9
2
/3
AMPN_ECOLI Aminopeptidase N
3qjx[1] E NA
SODIUM ION[1 atoms]
A 0.0
/30.3
2
/4
AMPN_ECOLI Aminopeptidase N
6q4r[1] PA NA
SODIUM ION[1 atoms]
A 50.0
/36.9
4
/4
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6rqx[1] UA NA
SODIUM ION[1 atoms]
A 50.0
/37.1
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ryf[11] C ZN
ZINC ION[1 atoms]
A 100.0
/36.9
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6bv0[61] X ZN
ZINC ION[1 atoms]
A 100.0
/79.8
3
/3
AMPN_PIG Aminopeptidase N
4e36[16] L ZN
ZINC ION[1 atoms]
A 100.0
/37.1
4
/4
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
4xo3[74] B ZN
ZINC ION[1 atoms]
A 100.0
/30.3
3
/3
AMPN_ECOLI Aminopeptidase N
5lhd[4] QB ZN
ZINC ION[1 atoms]
C 100.0
/100.0
3
/3
AMPN_HUMAN Aminopeptidase N
4pj6[97] D ZN
ZINC ION[1 atoms]
A 100.0
/36.7
4
/4
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5lds[10] Y ZN
ZINC ION[1 atoms]
B 100.0
/79.8
4
/4
AMPN_PIG Aminopeptidase N
6m8p[22] VG ZN
ZINC ION[1 atoms]
I 100.0
/36.9
5
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5fwq[3] C ZN
ZINC ION[1 atoms]
A 100.0
/30.1
4
/4
LKHA4_HUMAN HUMAN LEUKOTRIENE A4 HYDROLASE
6enc[2] B ZN
ZINC ION[1 atoms]
A 100.0
/30.1
4
/4
LKHA4_HUMAN Leukotriene A-4 hydrolase
4rsy[4] C ZN
ZINC ION[1 atoms]
A 100.0
/30.1
4
/4
LKHA4_HUMAN Leukotriene A-4 hydrolase
6rqx[3] M ZN
ZINC ION[1 atoms]
A 100.0
/37.1
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6atk[3] Y ZN
ZINC ION[1 atoms]
C 100.0
/100.0
4
/4
AMPN_HUMAN Aminopeptidase N
5dll[1] B ZN
ZINC ION[1 atoms]
A 100.0
/30.3
3
/3
Q5NE65_FRATT Aminopeptidase N
6ifg[2] O ZN
ZINC ION[1 atoms]
B 0.0
/34.4
2
/4
Q9RVZ5_DEIRA Zinc metalloprotease
4wz9[2] E ZN
ZINC ION[1 atoms]
A 100.0
/36.9
4
/4
Q7Q2T8_ANOGA AGAP004809-PA
6sbq[2] B ZN
ZINC ION[1 atoms]
A 100.0
/29.8
4
/4
Q8IEK1_PLAF7 M1-family alanyl aminopeptidase
3qnf[3] E ZN
ZINC ION[1 atoms]
A 100.0
/40.4
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
1z5h[8] U ZN
ZINC ION[1 atoms]
B 100.0
/37.1
4
/4
TRF3_THEAC Tricorn protease interacting factor F3
5z65[1] K ZN
ZINC ION[1 atoms]
A 100.0
/79.8
5
/5
K7GMF9_PIG Aminopeptidase
5mfr[3] BA CL
CHLORIDE ION[1 atoms]
A 0.0
/30.3
1
/5
AMPN_ECOLI Aminopeptidase N
5dll[1] L CL
CHLORIDE ION[1 atoms]
A 50.0
/30.3
4
/4
Q5NE65_FRATT Aminopeptidase N
5dll[1] P CL
CHLORIDE ION[1 atoms]
A 0.0
/30.3
5
/5
Q5NE65_FRATT Aminopeptidase N
5dll[1] Q CL
CHLORIDE ION[1 atoms]
A 0.0
/30.3
1
/4
Q5NE65_FRATT Aminopeptidase N
6sbr[1] F CL
CHLORIDE ION[1 atoms]
A 0.0
/29.8
1
/3
Q8IEK1_PLAF7 M1-family alanyl aminopeptidase
5dll[1] N CL
CHLORIDE ION[1 atoms]
A 0.0
/30.3
1
/2
Q5NE65_FRATT Aminopeptidase N
5dll[1] G CL
CHLORIDE ION[1 atoms]
A 0.0
/30.3
3
/3
Q5NE65_FRATT Aminopeptidase N
6end[2] E YB
YTTERBIUM (III) ION[1 atoms]
A 0.0
/30.1
1
/1
LKHA4_HUMAN Leukotriene A-4 hydrolase
5fwq[1] L YB
YTTERBIUM (III) ION[1 atoms]
A 0.0
/30.1
1
/1
LKHA4_HUMAN HUMAN LEUKOTRIENE A4 HYDROLASE
3fuf[13] E YB
YTTERBIUM (III) ION[1 atoms]
A 0.0
/30.1
1
/1
LKHA4_HUMAN Leukotriene A-4 hydrolase
3b7t[2] E YB
YTTERBIUM (III) ION[1 atoms]
A 0.0
/29.8
1
/1
LKHA4_HUMAN Leukotriene A-4 hydrolase
5ni6[1] D YB
YTTERBIUM (III) ION[1 atoms]
A 0.0
/30.1
1
/1
LKHA4_HUMAN Leukotriene A-4 hydrolase
3u9w[1] N YB
YTTERBIUM (III) ION[1 atoms]
A 100.0
/30.1
1
/2
LKHA4_HUMAN Leukotriene A-4 hydrolase
5bpp[1] D YB
YTTERBIUM (III) ION[1 atoms]
A 100.0
/30.1
1
/1
LKHA4_HUMAN Leukotriene A-4 hydrolase
3u9w[1] M YB
YTTERBIUM (III) ION[1 atoms]
A 0.0
/30.1
1
/1
LKHA4_HUMAN Leukotriene A-4 hydrolase
5bpp[1] C YB
YTTERBIUM (III) ION[1 atoms]
A 0.0
/30.1
1
/1
LKHA4_HUMAN Leukotriene A-4 hydrolase
4zx6[3] D MG
MAGNESIUM ION[1 atoms]
A 0.0
/28.5
1
/1
AMP1_PLAFQ M1 family aminopeptidase
5y1v[11] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/29.8
1
/1
AMP1_PLAFQ M1 family aminopeptidase
6ee4[8] M MG
MAGNESIUM ION[1 atoms]
A 0.0
/28.5
1
/1
AMP1_PLAFQ M1 family aminopeptidase
6ee4[14] O MG
MAGNESIUM ION[1 atoms]
A 100.0
/28.5
1
/1
AMP1_PLAFQ M1 family aminopeptidase
5y1q[7] E MG
MAGNESIUM ION[1 atoms]
A 100.0
/29.8
1
/1
AMP1_PLAFQ M1 family aminopeptidase
4zx3[5] D MG
MAGNESIUM ION[1 atoms]
A 100.0
/28.5
1
/1
AMP1_PLAFQ M1 family aminopeptidase
6eab[2] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/28.5
1
/1
AMP1_PLAFQ M1 family aminopeptidase
4k5l[2] D MG
MAGNESIUM ION[1 atoms]
A 100.0
/28.5
1
/1
AMP1_PLAFQ M1 family aminopeptidase
3q43[1] H MG
MAGNESIUM ION[1 atoms]
A 0.0
/28.5
1
/1
AMP1_PLAFQ M1 family aminopeptidase
5y1w[1] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/29.8
4
/4
AMP1_PLAFQ M1 family aminopeptidase
4r5x[1] F MG
MAGNESIUM ION[1 atoms]
A 100.0
/28.5
1
/1
AMP1_PLAFQ M1 family aminopeptidase
4j3b[1] D MG
MAGNESIUM ION[1 atoms]
A 100.0
/29.8
1
/1
AMP1_PLAFQ M1 family aminopeptidase
3ebg[1] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/28.5
2
/2
AMP1_PLAFQ M1 family aminopeptidase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
967 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5lhd[1] Y beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(.. C 100.0
/100.0
2
/2
AMPN_HUMAN Aminopeptidase N
5lhd[3] S beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(.. C 100.0
/100.0
6
/6
AMPN_HUMAN Aminopeptidase N
5lhd[1] AA beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1.. D 100.0
/100.0
7
/7
AMPN_HUMAN Aminopeptidase N
5lhd[1] W beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1.. C 100.0
/100.0
5
/5
AMPN_HUMAN Aminopeptidase N
5lds[1] E beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1.. A 0.0
/79.8
2
/2
AMPN_PIG Aminopeptidase N
5lhd[1] T beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1.. C 100.0
/100.0
5
/5
AMPN_HUMAN Aminopeptidase N
5lds[2] O beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1.. D 50.0
/79.8
2
/2
AMPN_PIG Aminopeptidase N
6buy[11] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 60.0
/79.8
5
/5
AMPN_PIG Aminopeptidase N
6bv3[7] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 60.0
/79.8
5
/5
AMPN_PIG Aminopeptidase N
5z65[1] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/79.8
4
/4
K7GMF9_PIG Aminopeptidase
4kxc[7] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/37.9
6
/8
AMPE_HUMAN Glutamyl aminopeptidase
4kxd[7] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/37.9
4
/4
AMPE_HUMAN Glutamyl aminopeptidase
6bv0[8] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/79.8
3
/3
AMPN_PIG Aminopeptidase N
4fke[3] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/79.8
4
/4
AMPN_PIG Aminopeptidase N
4fke[3] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/79.8
5
/5
AMPN_PIG Aminopeptidase N
3qnf[1] D alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. A 16.7
/40.4
6
/8
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5ab0[1] I beta-D-mannopyranose-(1-4)-[beta-D-mannopyranose-(.. B 25.0
/37.2
4
/5
ERAP2_HUMAN ENDOPLASMATIC RETICULUM AMINOPEPTIDASE 2
5k1v[5] E alpha-D-mannopyranose-(1-4)-alpha-D-mannopyranose-.. B 25.0
/37.5
4
/6
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
6bv0[17] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 83.3
/79.8
6
/6
AMPN_PIG Aminopeptidase N
4p8q[3] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 28.6
/36.7
7
/7
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6buy[9] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 66.7
/79.8
3
/3
AMPN_PIG Aminopeptidase N
6buy[9] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/79.8
1
/1
AMPN_PIG Aminopeptidase N
4e36[12] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/37.1
6
/7
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
5lhd[2] V 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/100.0
1
/1
AMPN_HUMAN Aminopeptidase N
6u7g[7] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
7
/7
AMPN_HUMAN Aminopeptidase N
5z65[1] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 75.0
/79.8
4
/4
K7GMF9_PIG Aminopeptidase
6u7e[19] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
3
/3
AMPN_HUMAN Aminopeptidase N
6bv2[19] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 60.0
/79.8
5
/5
AMPN_PIG Aminopeptidase N
6bv1[9] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 80.0
/79.8
5
/5
AMPN_PIG Aminopeptidase N
5lhd[3] EA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/100.0
7
/7
AMPN_HUMAN Aminopeptidase N
5z65[1] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/79.8
4
/4
K7GMF9_PIG Aminopeptidase
6ea4[3] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/37.2
3
/3
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
4kxd[13] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/37.9
2
/2
AMPE_HUMAN Glutamyl aminopeptidase
5lds[2] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 80.0
/79.8
5
/5
AMPN_PIG Aminopeptidase N
4jbs[10] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 60.0
/37.1
5
/5
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
4kxd[11] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 66.7
/37.9
3
/3
AMPE_HUMAN Glutamyl aminopeptidase
5lds[6] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 75.0
/79.8
4
/4
AMPN_PIG Aminopeptidase N
5mj6[4] Q 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 50.0
/36.9
2
/2
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5lhd[3] Q 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
3
/3
AMPN_HUMAN Aminopeptidase N
5lds[7] R 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 75.0
/79.8
4
/4
AMPN_PIG Aminopeptidase N
4ou3[2] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/79.8
3
/3
AMPN_PIG Aminopeptidase N
4nz8[2] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 60.0
/79.7
5
/5
AMPN_PIG Aminopeptidase N
5mj6[1] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/36.9
4
/4
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
4nz8[2] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 80.0
/79.7
5
/5
AMPN_PIG Aminopeptidase N
5mj6[5] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/36.9
1
/1
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[4] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/36.9
3
/3
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
4fyt[2] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
4
/4
AMPN_HUMAN Aminopeptidase N
4z7i[1] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/36.9
1
/3
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5ab2[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/36.6
2
/2
ERAP2_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 2
4naq[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/79.6
1
/1
AMPN_PIG Aminopeptidase N
4kx8[9] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/37.9
3
/3
AMPE_HUMAN Glutamyl aminopeptidase
4fkh[3] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/79.8
3
/3
AMPN_PIG Aminopeptidase N
5ab2[3] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/36.6
2
/2
ERAP2_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 2
4fke[3] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/79.8
1
/1
AMPN_PIG Aminopeptidase N
4fkk[3] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 80.0
/79.8
5
/5
AMPN_PIG Aminopeptidase N
4z7i[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/36.7
1
/1
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5ab2[4] M 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/37.0
2
/2
ERAP2_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 2
2yd0[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/37.5
3
/3
ERAP1_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 1
5z65[1] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/79.8
2
/2
K7GMF9_PIG Aminopeptidase
6mgq[1] K 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 40.0
/36.8
5
/7
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5lhd[1] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
3
/3
AMPN_HUMAN Aminopeptidase N
5lds[2] S 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 33.3
/79.8
3
/3
AMPN_PIG Aminopeptidase N
5lhd[1] GA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/100.0
2
/2
AMPN_HUMAN Aminopeptidase N
6ydx[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/37.0
3
/3
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
3mdj[1] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 25.0
/36.3
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
4ou3[2] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 60.0
/79.8
5
/5
AMPN_PIG Aminopeptidase N
6q4r[1] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 40.0
/36.9
5
/5
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
4nz8[2] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 60.0
/79.7
5
/5
AMPN_PIG Aminopeptidase N
5ab2[1] K 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/36.6
1
/1
ERAP2_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 2
6ea4[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/37.2
3
/3
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
4nz8[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 75.0
/79.7
4
/4
AMPN_PIG Aminopeptidase N
4z7i[2] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/36.9
1
/1
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
4z7i[1] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/36.7
2
/2
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5lhd[3] E beta-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1.. A 100.0
/100.0
6
/6
AMPN_HUMAN Aminopeptidase N
5lhd[1] J beta-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1.. A 100.0
/100.0
6
/6
AMPN_HUMAN Aminopeptidase N
5ab2[1] L beta-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1.. B 0.0
/37.0
3
/4
ERAP2_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 2
6m8p[22] ZA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. O 0.0
/36.9
1
/1
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6m8p[22] IA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. G 0.0
/36.9
5
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5lhd[1] O beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/100.0
1
/1
AMPN_HUMAN Aminopeptidase N
6ea4[5] H beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 66.7
/37.2
6
/6
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
5lhd[3] U beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/100.0
3
/3
AMPN_HUMAN Aminopeptidase N
4fyq[5] B beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
7
/7
AMPN_HUMAN Aminopeptidase N
5lhd[3] Z beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. D 100.0
/100.0
6
/6
AMPN_HUMAN Aminopeptidase N
6u7e[1] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/100.0
6
/6
AMPN_HUMAN Aminopeptidase N
6ydx[1] H beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 33.3
/36.9
6
/6
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5ab0[1] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 20.0
/36.8
5
/5
ERAP2_HUMAN ENDOPLASMATIC RETICULUM AMINOPEPTIDASE 2
6mgq[1] I beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 28.6
/37.0
7
/9
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6u7e[1] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
5
/5
AMPN_HUMAN Aminopeptidase N
5mj6[2] N beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 28.6
/36.9
7
/7
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[2] P beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 0.0
/36.9
3
/3
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[1] D beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/36.9
4
/4
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6q4r[2] C beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/36.9
4
/4
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6ydx[1] D beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 33.3
/37.0
3
/3
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6ea4[3] G alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 33.3
/37.2
6
/7
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
5mj6[1] G alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 33.3
/36.9
3
/3
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[2] I alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 40.0
/36.9
5
/5
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
3mdj[2] D alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 0.0
/36.8
6
/8
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5cu5[1] C alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 0.0
/37.0
4
/6
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
4z7i[1] G alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 20.0
/36.7
5
/5
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[1] C alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 28.6
/36.9
7
/7
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5mj6[1] R alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 25.0
/36.9
4
/4
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6mgq[1] G alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 16.7
/36.6
6
/8
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
967 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4fyq[6] A AMPN_HUMAN Aminopeptidase N[892 aa] A 100.0
/100.0
20
/20
AMPN_HUMAN Aminopeptidase N
5lds[6] A AMPN_PIG Aminopeptidase N[900 aa] B 85.0
/79.8
20
/20
AMPN_PIG Aminopeptidase N
4ou3[2] A AMPN_PIG Aminopeptidase N[902 aa] A 81.0
/79.8
21
/21
AMPN_PIG Aminopeptidase N
1z5h[2] B TRF3_THEAC Tricorn protease interacting factor F3[780 aa] A 8.3
/37.1
12
/12
TRF3_THEAC Tricorn protease interacting factor F3
1z5h[2] A TRF3_THEAC Tricorn protease interacting factor F3[780 aa] B 31.2
/37.1
16
/16
TRF3_THEAC Tricorn protease interacting factor F3
1z5h[2] A TRF3_THEAC Tricorn protease interacting factor F3[780 aa] A 50.0
/37.1
2
/13
TRF3_THEAC Tricorn protease interacting factor F3
4wz9[1] B Q7Q2T8_ANOGA AGAP004809-PA[887 aa] A 33.3
/36.9
12
/20
Q7Q2T8_ANOGA AGAP004809-PA
4wz9[1] A Q7Q2T8_ANOGA AGAP004809-PA[882 aa] B 15.4
/36.9
13
/19
Q7Q2T8_ANOGA AGAP004809-PA
4pj6[4] B LCAP_HUMAN Leucyl-cystinyl aminopeptidase[849 aa] A 31.6
/36.7
19
/19
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
4gaa[2] B Q6IP81_XENLA MGC78867 protein[605 aa] A 20.0
/32.1
10
/24
Q6IP81_XENLA MGC78867 protein
5ni4[1] B LKHA4_HUMAN Leukotriene A-4 hydrolase[608 aa] C 33.3
/29.8
6
/10
LKHA4_HUMAN Leukotriene A-4 hydrolase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
967 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6buy[1] M GLY
GLYCINE[5 atoms]
A 100.0
/79.8
7
/7
AMPN_PIG Aminopeptidase N
3se6[6] J MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 50.0
/37.2
8
/8
ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2
6rqx[1] S SCN
THIOCYANATE ION[3 atoms]
A 25.0
/37.1
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] T SCN
THIOCYANATE ION[3 atoms]
A 20.0
/37.1
5
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] N SCN
THIOCYANATE ION[3 atoms]
A 14.3
/37.1
7
/7
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] V SCN
THIOCYANATE ION[3 atoms]
A 0.0
/37.1
2
/2
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] R SCN
THIOCYANATE ION[3 atoms]
A 40.0
/37.1
5
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] P SCN
THIOCYANATE ION[3 atoms]
A 66.7
/37.1
6
/6
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] X SCN
THIOCYANATE ION[3 atoms]
A 33.3
/37.1
3
/3
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] U SCN
THIOCYANATE ION[3 atoms]
A 0.0
/37.1
2
/2
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] O SCN
THIOCYANATE ION[3 atoms]
A 25.0
/37.1
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] Q SCN
THIOCYANATE ION[3 atoms]
A 75.0
/37.1
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] W SCN
THIOCYANATE ION[3 atoms]
A 100.0
/37.1
2
/2
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] YA PGE
TRIETHYLENE GLYCOL[10 atoms]
A 50.0
/37.1
4
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] AB PGE
TRIETHYLENE GLYCOL[10 atoms]
A 33.3
/37.1
3
/3
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] ZA PGE
TRIETHYLENE GLYCOL[10 atoms]
A 20.0
/37.1
5
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5lhd[6] RB EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
5
/5
AMPN_HUMAN Aminopeptidase N
6ryf[2] E EDO
1,2-ETHANEDIOL[4 atoms]
A 20.0
/36.9
5
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ydx[1] R EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/37.0
3
/3
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6ryf[3] G EDO
1,2-ETHANEDIOL[4 atoms]
A 71.4
/36.9
7
/7
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ryf[1] Y EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/36.9
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5lhd[4] LB EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
7
/7
AMPN_HUMAN Aminopeptidase N
6ryf[1] V EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/36.9
3
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ryf[1] P EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/36.9
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ryf[1] L EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/36.9
3
/3
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ryf[1] N EDO
1,2-ETHANEDIOL[4 atoms]
A 16.7
/36.9
6
/6
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ryf[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 28.6
/36.9
7
/7
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ryf[2] J EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/36.9
3
/3
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6q4r[3] AA EDO
1,2-ETHANEDIOL[4 atoms]
A 40.0
/36.9
5
/5
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6ydx[11] FA EDO
1,2-ETHANEDIOL[4 atoms]
B 0.0
/36.9
2
/2
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6q4r[4] EA EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/36.9
4
/4
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6q4r[1] DA EDO
1,2-ETHANEDIOL[4 atoms]
A 75.0
/36.9
4
/4
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6ryf[1] T EDO
1,2-ETHANEDIOL[4 atoms]
A 20.0
/36.9
5
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5lhd[2] OB EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
AMPN_HUMAN Aminopeptidase N
6q4r[1] IA EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/36.9
2
/3
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6q4r[4] HA EDO
1,2-ETHANEDIOL[4 atoms]
A 20.0
/36.9
5
/5
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6q4r[2] Z EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/36.9
1
/1
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6q4r[2] P EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/36.9
6
/6
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6q4r[5] R EDO
1,2-ETHANEDIOL[4 atoms]
A 60.0
/36.9
10
/10
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6q4r[6] T EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/36.9
6
/6
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6q4r[1] V EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/36.9
3
/3
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6rqx[1] Y EDO
1,2-ETHANEDIOL[4 atoms]
A 37.5
/37.1
8
/8
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6q4r[1] LA EDO
1,2-ETHANEDIOL[4 atoms]
A 75.0
/36.9
4
/4
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6rqx[1] GA EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/37.1
6
/6
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6q4r[1] W EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/36.9
2
/4
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
5ab2[1] S EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/36.6
1
/1
ERAP2_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 2
6rqx[2] QA EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/37.1
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[3] TA EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/37.1
3
/3
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] HA EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/37.1
3
/3
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
3rjo[2] C EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/28.1
3
/6
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5lhd[2] BC EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
3
/3
AMPN_HUMAN Aminopeptidase N
6rqx[2] MA EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/37.1
5
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] LA EDO
1,2-ETHANEDIOL[4 atoms]
A 20.0
/37.1
5
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5lhd[4] AB EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
8
/8
AMPN_HUMAN Aminopeptidase N
5lhd[2] UA EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
AMPN_HUMAN Aminopeptidase N
6q4r[1] N EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/36.9
8
/8
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6ydx[1] DA EDO
1,2-ETHANEDIOL[4 atoms]
B 33.3
/36.9
3
/3
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6t6r[1] V EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/36.5
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6t6r[1] T EDO
1,2-ETHANEDIOL[4 atoms]
A 16.7
/36.5
6
/6
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5lhd[3] IC EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
7
/7
AMPN_HUMAN Aminopeptidase N
6t6r[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/36.5
7
/7
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] AA EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/37.1
6
/6
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5ab2[2] Z EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/37.0
2
/2
ERAP2_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 2
6ydx[2] S EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/37.0
1
/1
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
5ab2[1] AA EDO
1,2-ETHANEDIOL[4 atoms]
B 50.0
/37.0
2
/2
ERAP2_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 2
5lhd[1] KC EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
5
/5
AMPN_HUMAN Aminopeptidase N
5lhd[1] PA EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
7
/7
AMPN_HUMAN Aminopeptidase N
6ryf[1] M EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/36.9
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ryf[2] O EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/36.9
6
/6
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ryf[1] I EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/36.9
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ryf[1] K EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/36.9
2
/2
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5lhd[1] LA EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
AMPN_HUMAN Aminopeptidase N
6ydx[1] EA EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/36.9
1
/1
LCAP_HUMAN Leucyl-cystinyl aminopeptidase
6ryf[1] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/36.9
6
/6
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ryf[1] Q EDO
1,2-ETHANEDIOL[4 atoms]
A 77.8
/36.9
9
/9
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] PA EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/37.1
3
/3
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6ryf[1] U EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/36.9
2
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5lhd[2] HC EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
4
/4
AMPN_HUMAN Aminopeptidase N
6rqx[1] NA EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/37.1
2
/2
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6rqx[1] SA EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/37.1
2
/6
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
5lhd[1] VA EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
AMPN_HUMAN Aminopeptidase N
5lhd[1] SA EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
AMPN_HUMAN Aminopeptidase N
6q4r[1] K EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/36.9
2
/2
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
5lhd[1] NB EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
7
/7
AMPN_HUMAN Aminopeptidase N
6q4r[2] Y EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/36.9
2
/2
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6q4r[2] Q EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/36.9
4
/4
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
5lhd[1] KB EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
4
/4
AMPN_HUMAN Aminopeptidase N
5lhd[1] XB EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
4
/4
AMPN_HUMAN Aminopeptidase N
5lhd[2] GB EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
6
/6
AMPN_HUMAN Aminopeptidase N
5lhd[3] OA EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
7
/7
AMPN_HUMAN Aminopeptidase N
6rqx[1] FA EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/37.1
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
3rjo[1] B EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/28.1
2
/2
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6q4r[3] CA EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/36.9
3
/3
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6q4r[1] O EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/36.9
8
/8
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
5lhd[1] SB EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
5
/5
AMPN_HUMAN Aminopeptidase N
6q4r[1] GA EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/36.9
4
/5
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
5lhd[2] HB EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
6
/6
AMPN_HUMAN Aminopeptidase N
6q4r[1] JA EDO
1,2-ETHANEDIOL[4 atoms]
A 16.7
/36.9
6
/6
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
5lhd[1] DB EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
2
/2
AMPN_HUMAN Aminopeptidase N
5lhd[1] CC EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
8
/8
AMPN_HUMAN Aminopeptidase N
2yd0[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/37.5
4
/4
ERAP1_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 1
5lhd[1] EB EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
2
/2
AMPN_HUMAN Aminopeptidase N
5ab0[1] Q EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/36.8
5
/5
ERAP2_HUMAN ENDOPLASMATIC RETICULUM AMINOPEPTIDASE 2
5ab2[1] Y EDO
1,2-ETHANEDIOL[4 atoms]
B 0.0
/37.0
2
/2
ERAP2_HUMAN ENDOPLASMIC RETICULUM AMINOPEPTIDASE 2
6ryf[1] DA PPI
PROPANOIC ACID[5 atoms]
A 0.0
/36.9
2
/2
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6q4r[1] NA P6G
HEXAETHYLENE GLYCOL[19 atoms]
A 0.0
/36.9
5
/5
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6q4r[1] OA PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 53.8
/36.9
13
/13
ERAP1_HUMAN ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1,Endoplasmic..
6m8p[42] SN SO4
SULFATE ION[5 atoms]
S 0.0
/36.9
2
/2
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6m8p[22] HP SO4
SULFATE ION[5 atoms]
U 0.0
/36.9
2
/2
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6m8p[2] TI SO4
SULFATE ION[5 atoms]
K 0.0
/36.9
2
/2
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6m8p[22] EM SO4
SULFATE ION[5 atoms]
Q 25.0
/36.9
4
/4
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6m8p[38] RH SO4
SULFATE ION[5 atoms]
J 0.0
/36.9
3
/3
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6m8p[22] ZK SO4
SULFATE ION[5 atoms]
O 25.0
/36.9
4
/5
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1
6buy[8] N SO4
SULFATE ION[5 atoms]
A 87.5
/79.8
8
/8
AMPN_PIG Aminopeptidase N