[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
55936 1170 326 P20701(ITAL_HUMAN) RecName: Full=Integrin alpha-L;AltName: Full=CD11 antigen-like family member A;AltName: Full=Leukocyte adhesion glycoprotein LFA-1 alpha chain; Short=LFA-1A;AltName: Full=Leukocyte function-associated molecule 1 alpha chain;AltName: CD_antigen=CD11a;Flags: Precursor;
QUERYSEQ
MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGAPGEGNSTGSLYQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCDQNTYLSGLCYLFRQNLQGPMLQGRPGFQEC
IKGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLH
KFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSRGHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLLASGAPRYQHMGRVLLFQEPQGGGHWSQVQT
IHGTQIGSYFGGELCGVDVDQDGETELLLIGAPLFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVAVGAPLEEQGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVA
VGAESQMIVLSSRPVVDMVTLMSFSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSLIPQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQDLISPINVSLNFSLWEEEGTPRDQRAQGKDI
PPILRPSLHSETWEIPFEKNCGEDKKCEANLRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQIPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTC
NNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFS
LCSSLSISFNSSKHFHLYGSNASLAQVVMKVDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSESGGGKD
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P20701(ITAL_HUMAN)]

1170
region name description
1-25 SIGNAL
26-1170 CHAIN /note="Integrin alpha-L" /id="PRO_0000016292"
26-1090 TOPO_DOM /note="Extracellular"
1091-1111 TRANSMEM /note="Helical"
1112-1170 TOPO_DOM /note="Cytoplasmic"
31-82 REPEAT /note="FG-GAP 1"
83-141 REPEAT /note="FG-GAP 2"
156-327 DOMAIN /note="VWFA"
338-389 REPEAT /note="FG-GAP 3"
390-445 REPEAT /note="FG-GAP 4"
446-506 REPEAT /note="FG-GAP 5"
507-563 REPEAT /note="FG-GAP 6"
567-627 REPEAT /note="FG-GAP 7"
468-476 CA_BIND
530-538 CA_BIND
590-598 CA_BIND
1-1170 DISORDER predicted by DISOPRED (1-23,140-140,738-746,841-848,988-1014,1125-1170)

MONOMER
1170
pdb_id a1 identity[%]2 description
5e6u A 99.8 ITAL_HUMAN Integrin alpha-L
3k6s A 37.7 ITAX_HUMAN Integrin alpha-X
2k8o A 98.3 ITAL_HUMAN Integrin alpha-L
2m3e A 100.0 ITAL_HUMAN Integrin alpha-L
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
1170 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3eoa[4] C Efalizumab Fab fragment, heavy chain[215 aa] E 100.0
/100.0
14
/14
ITAL_HUMAN Integrin alpha-L
3eoa[4] A Efalizumab Fab fragment, light chain[214 aa] E 100.0
/100.0
1
/1
ITAL_HUMAN Integrin alpha-L
5e6s[7] B ITB2_HUMAN Integrin beta-2[455 aa] A 100.0
/99.8
35
/35
ITAL_HUMAN Integrin alpha-L
3tcx[14] W ICAM1_HUMAN Intercellular adhesion molecule 1[85 aa] X 100.0
/98.9
13
/13
ITAL_HUMAN Integrin alpha-L
1mq8[2] C ICA1_HUMAN intercellular adhesion molecule-1[184 aa] D 100.0
/98.9
15
/15
ITAL_HUMAN Integrin alpha-L
3hi6[2] E Heavy chain of Fab fragment of AL-57 against alpha.. B 100.0
/98.3
14
/14
ITAL_HUMAN Integrin alpha-L
3hi6[2] F light chain of Fab fragment of AL-57 against alpha.. B 100.0
/98.3
9
/9
ITAL_HUMAN Integrin alpha-L
3bn3[1] B ICAM5_HUMAN Intercellular adhesion molecule 5[196 aa] A 100.0
/98.3
17
/17
ITAL_HUMAN Integrin alpha-L
1t0p[1] B ICAM3_HUMAN Intercellular adhesion molecule-3[86 aa] A 100.0
/98.3
14
/14
ITAL_HUMAN Integrin alpha-L
4wk2[9] C GLY-ARG-GLY-ASP-SER-PRO[6 aa] A 0.0
/35.3
3
/6
ITA5_HUMAN Integrin alpha-5
3zdz[2] I RGD PEPTIDE[5 aa] C 0.0
/38.0
1
/5
ITA2B_HUMAN INTEGRIN ALPHA-IIB
2vdp[1] C Q53Y18_HUMAN FIBRINOGEN[8 aa] A 0.0
/37.7
1
/9
ITA2B_HUMAN INTEGRIN ALPHA-IIB
2vdr[1] C Q53Y18_HUMAN FIBRINOGEN[7 aa] A 0.0
/37.7
1
/8
ITA2B_HUMAN INTEGRIN ALPHA-IIB
2vdn[1] C EPTIFIBATIDE[8 aa] A 0.0
/37.7
1
/6
ITA2B_HUMAN INTEGRIN ALPHA-IIB
2vdo[1] C Q53Y18_HUMAN FIBRINOGEN, GAMMA POLYPEPTIDE[12 aa] A 0.0
/37.7
1
/12
ITA2B_HUMAN INTEGRIN ALPHA-IIB
3zdy[45] D ITB3_HUMAN INTEGRIN BETA-3[469 aa] C 41.2
/38.0
17
/37
ITA2B_HUMAN INTEGRIN ALPHA-IIB
6v4p[1] B ITB3_HUMAN Integrin beta-3[375 aa] A 36.8
/37.7
19
/43
ITA2B_HUMAN Integrin alpha-IIb
2vdq[1] C Q53Y18_HUMAN FIBRINOGEN, GAMMA POLYPEPTIDE[7 aa] A 0.0
/37.7
1
/8
ITA2B_HUMAN INTEGRIN ALPHA-IIB
3k72[18] B ITB2_HUMAN Integrin beta-2[673 aa] A 36.7
/37.7
49
/52
ITAX_HUMAN Integrin alpha-X
6rhw[8] B A0A0D6HC73_STAAU Beta-channel forming cytolysin[271 aa] C 35.3
/35.3
17
/18
ITAM_HUMAN Integrin alpha-M
3q3g[8] B Antibody Heavy chain[224 aa] C 30.8
/35.6
13
/13
ITAM_HUMAN Integrin alpha-M
4wk0[1] C ARG-GLY-ASP[3 aa] A 0.0
/35.3
3
/6
ITA5_HUMAN Integrin alpha-5
6rhw[8] A A0A0D6HCK9_STAAU Beta-channel forming cytolysin[272 aa] C 0.0
/35.3
4
/4
ITAM_HUMAN Integrin alpha-M
4m76[1] A CO3_HUMAN Complement C3[296 aa] B 38.5
/35.1
13
/13
ITAM_HUMAN Integrin alpha-M
3q3g[8] G Antibody Light Chain[220 aa] I 28.6
/35.6
7
/7
ITAM_HUMAN Integrin alpha-M
4wk4[1] C ALA-CYS-ARG-GLY-ASP-GLY-TRP-CYS[8 aa] A 0.0
/34.8
3
/7
ITA5_HUMAN Integrin alpha-5
3v4v[4] B ITB7_HUMAN Integrin beta-7[375 aa] A 50.0
/34.7
18
/31
ITA4_HUMAN Integrin alpha-4
4irz[1] B Fab Natalizumab light chain[208 aa] A 0.0
/34.4
4
/5
Integrin alpha4 subunit
4irz[1] C Fab Natalizumab heavy chain[217 aa] A 7.1
/34.4
14
/15
Integrin alpha4 subunit
6ujb[7] B ITB8_HUMAN Integrin beta-8[359 aa] A 35.3
/32.4
17
/38
ITAV_HUMAN Integrin alpha-V
3vi4[1] I RGD peptide[4 aa] C 0.0
/32.9
5
/7
ITA5_HUMAN Integrin alpha-5
3vi3[8] B ITB1_HUMAN Integrin beta-1[427 aa] A 30.0
/32.6
20
/35
ITA5_HUMAN Integrin alpha-5
3vi4[1] J RGD peptide[3 aa] A 0.0
/32.6
5
/6
ITA5_HUMAN Integrin alpha-5
5neu[62] F ITB6_HUMAN Integrin beta-6[448 aa] E 22.2
/32.4
9
/25
ITAV_HUMAN Integrin alpha-V
4um8[6] D ITB6_HUMAN INTEGRIN BETA-6[414 aa] C 37.5
/32.3
16
/38
ITAV_HUMAN INTEGRIN ALPHA-V
6om2[1] D ITB8_HUMAN Integrin beta-8[330 aa] C 41.2
/32.4
17
/39
ITAV_HUMAN Integrin alpha-V
5ffo[3] B ITB6_HUMAN Integrin beta-6[242 aa] A 41.2
/32.8
17
/37
ITAV_HUMAN Integrin alpha-V
6om2[1] B ITB8_HUMAN Integrin beta-8[310 aa] A 37.5
/32.4
16
/38
ITAV_HUMAN Integrin alpha-V
2b2x[2] B Antibody AQC2 Fab[210 aa] A 23.1
/30.1
13
/14
ITA1_RAT Integrin alpha-1
2b2x[2] C Antibody AQC2 Fab[210 aa] A 12.5
/30.1
8
/9
ITA1_RAT Integrin alpha-1
1mhp[1] C FAB FRAGMENT, light chain[212 aa] A 16.7
/31.6
6
/7
ITA1_RAT integrin alpha 1, (RESIDUES 169-360)
1mhp[1] B Fab fragment, heavy chain[219 aa] A 23.1
/31.6
13
/13
ITA1_RAT integrin alpha 1, (RESIDUES 169-360)
1mhp[1] F FAB FRAGMENT, light chain[105 aa] D 14.3
/30.1
7
/8
ITA1_RAT integrin alpha 1, (RESIDUES 169-360)
1mhp[1] E Fab fragment, heavy chain[118 aa] D 21.4
/30.1
14
/16
ITA1_RAT integrin alpha 1, (RESIDUES 169-360)
4bj3[4] E GFOGER PEPTIDE[18 aa] A 50.0
/29.2
8
/8
ITA2_HUMAN INTEGRIN ALPHA-2
6ndg[66] A SLEC_CALRH Snaclec rhodocetin subunit gamma[131 aa] C 0.0
/29.2
6
/6
ITA2_HUMAN Integrin alpha-2
6ndg[66] Q SLED_CALRH Snaclec rhodocetin subunit delta[122 aa] R 40.0
/29.2
5
/10
ITA2_HUMAN Integrin alpha-2
1v7p[1] B Q7T2Q0_ECHML EMS16 B chain[127 aa] C 44.4
/29.2
9
/14
ITA2_HUMAN Integrin alpha-2
1dzi[1] C COLLAGEN[22 aa] A 40.0
/29.2
10
/10
ITA2_HUMAN INTEGRIN
1dzi[1] B COLLAGEN[22 aa] A 22.2
/29.2
9
/9
ITA2_HUMAN INTEGRIN
1v7p[1] A Q7T2Q1_ECHML EMS16 A chain[134 aa] C 0.0
/29.2
7
/7
ITA2_HUMAN Integrin alpha-2
1u8c[1] B ITB3_HUMAN Integrin beta-3[599 aa] A 32.1
/29.2
28
/57
ITAV_HUMAN Integrin alpha-V
6naj[2] C FINC_HUMAN Fibronectin, HR10 variant[90 aa] A 16.7
/29.2
6
/7
ITAV_HUMAN Integrin alpha-V
3fcs[2] D ITB3_HUMAN Integrin beta-3[603 aa] C 25.9
/30.9
27
/57
Q17R67_HUMAN Integrin, alpha 2b
3ije[12] B ITB3_HUMAN Integrin beta-3[695 aa] A 31.2
/29.2
32
/66
ITAV_HUMAN Integrin alpha-V
6avr[2] B ITB3_HUMAN Integrin beta-3[685 aa] A 22.2
/29.2
9
/17
ITAV_HUMAN Integrin alpha-V
4cak[1] B ITB3_HUMAN Integrin beta-3[680 aa] A 36.7
/30.9
120
/169
ITA2B_HUMAN Integrin alpha-IIb
4mmy[1] C FINC_HUMAN Fibronectin[8 aa] A 20.0
/29.2
5
/6
ITAV_HUMAN Integrin alpha-V
6msu[1] C Engineered EETI-II 2.5F[32 aa] A 20.0
/29.2
5
/6
ITAV_HUMAN Integrin alpha-V
4mmx[1] C FINC_HUMAN Fibronectin[93 aa] A 25.0
/29.2
4
/5
ITAV_HUMAN Integrin alpha-V
6msl[1] C Cystine Knot Protein 2.5D[32 aa] A 20.0
/29.2
5
/6
ITAV_HUMAN Integrin alpha-V
1l5g[3] B ITB3_HUMAN INTEGRIN BETA-3[539 aa] A 34.6
/29.2
26
/57
INTEGRIN ALPHA V
4o02[1] C 17E6 light chain[214 aa] A 0.0
/29.2
2
/3
ITAV_HUMAN Integrin alpha-V
4o02[1] D 17E6 heavy chain[218 aa] A 16.7
/29.2
12
/16
ITAV_HUMAN Integrin alpha-V
1l5g[1] C CYCLIC ARG-GLY-ASP PEPTIDE[5 aa] A 0.0
/29.2
3
/4
INTEGRIN ALPHA V
1qc5[1] B ITA1_HUMAN PROTEIN (ALPHA1 BETA1 INTEGRIN)[190 aa] A 0.0
/28.1
3
/4
ITA1_HUMAN PROTEIN (ALPHA1 BETA1 INTEGRIN)
1qc5[1] A ITA1_HUMAN PROTEIN (ALPHA1 BETA1 INTEGRIN)[192 aa] B 0.0
/28.8
6
/7
ITA1_HUMAN PROTEIN (ALPHA1 BETA1 INTEGRIN)
2m32[2] C GLOGEN peptide[23 aa] A 37.5
/28.8
8
/8
ITA1_HUMAN Integrin alpha-1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
1170 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2ica[1] B 2IC
5-[(5S,9R)-9-(4-CYANOPHENYL)-3-(3,5-DICHLOROPHENYL..
A 100.0
/100.0
12
/12
ITAL_HUMAN Integrin alpha-L
1rd4[4] F L08
1-ACETYL-4-(4-{4-[(2-ETHOXYPHENYL)THIO]-3-NITROPHE..
B 100.0
/100.0
19
/19
ITAL_HUMAN Integrin alpha-L
2o7n[1] B 2O7
7A-[(4-cyanophenyl)methyl]-6-(3,5-dichlorophenyl)-..
A 100.0
/100.0
12
/12
ITAL_HUMAN Integrin alpha-L
3m6f[1] B BJZ
6-[(5S,9R)-9-(4-cyanophenyl)-3-(3,5-dichlorophenyl..
A 100.0
/100.0
15
/15
ITAL_HUMAN Integrin alpha-L
1xdd[2] F AAY
8-[2-((2S)-4-HYDROXY-1-{[5-(HYDROXYMETHYL)-6-METHO..
B 100.0
/99.5
12
/12
ITAL_HUMAN Integrin alpha-L
1xdg[2] D AB8
(1S,3R,8AS)-8-(2-{(4S,6S)-3-(4-HYDROXY-3-METHOXYBE..
A 100.0
/99.5
10
/10
ITAL_HUMAN Integrin alpha-L
3e2m[2] D E2M
cis-4-{[2-({4-[(1E)-3-morpholin-4-yl-3-oxoprop-1-e..
A 100.0
/99.5
2
/2
ITAL_HUMAN Integrin alpha-L
3e2m[2] D E2M
cis-4-{[2-({4-[(1E)-3-morpholin-4-yl-3-oxoprop-1-e..
B 100.0
/99.5
16
/16
ITAL_HUMAN Integrin alpha-L
4ixd[2] C 1HV
4-(3-{4-[(3-aminopropyl)carbamoyl]phenyl}-1H-indaz..
A 100.0
/99.5
1
/1
ITAL_HUMAN Integrin alpha-L
4ixd[2] C 1HV
4-(3-{4-[(3-aminopropyl)carbamoyl]phenyl}-1H-indaz..
A 100.0
/99.5
9
/9
ITAL_HUMAN Integrin alpha-L
3bqn[2] C BQN
4-{(2E)-3-[4-{[2-(pyridin-3-ylmethoxy)phenyl]sulfa..
B 100.0
/99.5
2
/2
ITAL_HUMAN Integrin alpha-L
3bqn[2] D BQN
4-{(2E)-3-[4-{[2-(pyridin-3-ylmethoxy)phenyl]sulfa..
B 100.0
/99.5
18
/18
ITAL_HUMAN Integrin alpha-L
3bqm[2] D BQM
3-({4-[(1E)-3-morpholin-4-yl-3-oxoprop-1-en-1-yl]-..
A 100.0
/99.5
1
/1
ITAL_HUMAN Integrin alpha-L
3bqm[2] D BQM
3-({4-[(1E)-3-morpholin-4-yl-3-oxoprop-1-en-1-yl]-..
B 100.0
/99.5
15
/15
ITAL_HUMAN Integrin alpha-L
1cqp[2] D 803
LOVASTATIN[29 atoms]
A 100.0
/99.5
9
/9
ITAL_HUMAN ANTIGEN CD11A (P180)
1xuo[1] D LA1
(2R)-2-[3-ISOBUTYL-2,5-DIOXO-4-(QUINOLIN-3-YLMETHY..
A 100.0
/99.4
14
/14
ITAL_HUMAN Integrin alpha-L
3f78[2] F ICF
1-CHLORO-2,2,2-TRIFLUOROETHYL DIFLUOROMETHYL ETHER..
B 100.0
/99.4
9
/9
ITAL_HUMAN Integrin alpha-L
5hdb[2] GA 5YB
N-(4-carbamimidoylbenzoyl)-beta-alanyl-L-alpha-asp..
C 0.0
/38.0
1
/7
ITA2B_HUMAN Integrin alpha-IIb
3nif[2] Q NIF
2-ethyl-7-piperazin-1-yl-5H-[1,3,4]thiadiazolo[3,2..
A 0.0
/38.3
1
/7
ITA2B_HUMAN Integrin alphaIIB beta3
3t3m[2] Q RC2
N-{3-[5-oxo-7-(piperazin-1-yl)-5H-[1,3,4]thiadiazo..
A 0.0
/38.3
1
/8
ITA2B_HUMAN Integrin alpha-IIb
3k6s[1] U MAN
alpha-D-mannopyranose[11 atoms]
A 100.0
/37.7
2
/2
ITAX_HUMAN Integrin alpha-X
4um9[1] LA MAN
alpha-D-mannopyranose[11 atoms]
C 0.0
/32.3
3
/3
ITAV_HUMAN INTEGRIN ALPHA-V
4z7q[1] EA MAN
alpha-D-mannopyranose[11 atoms]
C 0.0
/38.0
1
/1
ITA2B_HUMAN Integrin alpha-IIb
2vdm[1] N AGG
TIROFIBAN[30 atoms]
A 0.0
/37.7
1
/8
ITA2B_HUMAN INTEGRIN ALPHA-IIB
2vc2[1] O 180
2-(S)-[N-(3-PYRIDYLSULFONYL)AMINO]-3-[[2-CARBONYL-..
A 0.0
/37.7
1
/8
ITA2B_HUMAN INTEGRIN ALPHA-IIB
4xw2[1] C SIM
Simvastatin acid[31 atoms]
A 42.9
/34.9
7
/7
ITAM_HUMAN Integrin alpha-M
3v4v[2] X 0DU
N-(2,6-dichlorobenzoyl)-4-[1,6-dimethyl-2-oxo-4-(t..
A 0.0
/34.7
2
/2
ITA4_HUMAN Integrin alpha-4
4irz[1] M NDS
ETHYL DIMETHYL AMMONIO PROPANE SULFONATE[12 atoms]..
A 80.0
/34.4
5
/8
Integrin alpha4 subunit
1m1x[10] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/29.2
2
/2
Integrin alpha-V
3vi4[5] FA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/32.9
1
/1
ITA5_HUMAN Integrin alpha-5
4mmz[3] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 25.0
/29.2
4
/4
ITAV_HUMAN Integrin alpha-V
4neh[10] M NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 33.3
/37.6
3
/3
ITAX_HUMAN Integrin alpha-X
5ner[12] P NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
E 0.0
/32.4
3
/3
ITAV_HUMAN Integrin alpha-V
5es4[4] NA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 25.0
/37.5
4
/4
ITAX_HUMAN Integrin alpha-X
2vdq[9] N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/37.7
1
/1
ITA2B_HUMAN INTEGRIN ALPHA-IIB
6om1[9] HB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
E 0.0
/31.9
2
/3
ITAV_HUMAN Integrin alpha-V
3k72[16] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/37.7
3
/3
ITAX_HUMAN Integrin alpha-X
5es4[4] QA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 50.0
/37.5
4
/4
ITAX_HUMAN Integrin alpha-X
6mk0[12] T NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/29.2
2
/2
ITAV_HUMAN Integrin alpha-V
6ckb[4] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.4
2
/2
ITB3_HUMAN ITAL_HUMAN ITB3_HUMAN Chimera protein of Integrin beta-3 and Integrin al..
5e6s[7] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
3
/3
ITAL_HUMAN Integrin alpha-L
3vi3[4] U NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 66.7
/32.6
6
/6
ITA5_HUMAN Integrin alpha-5
3vi3[3] FA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 20.0
/32.9
5
/5
ITA5_HUMAN Integrin alpha-5
3v4p[5] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.7
3
/3
ITA4_HUMAN Integrin alpha-4
1m1x[4] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 12.5
/29.2
8
/8
Integrin alpha-V
3gxb[2] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/25.7
1
/2
VWF_HUMAN von Willebrand factor
5es4[4] JB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
G 100.0
/37.5
1
/1
ITAX_HUMAN Integrin alpha-X
4mmy[4] N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/29.2
1
/1
ITAV_HUMAN Integrin alpha-V
3zqk[1] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/24.5
4
/4
VWF_HUMAN VON WILLEBRAND FACTOR
3zqk[1] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/24.5
2
/2
VWF_HUMAN VON WILLEBRAND FACTOR
5nem[1] O NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
E 0.0
/32.5
3
/3
ITAV_HUMAN Integrin alpha-V
6om2[6] X NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/32.4
2
/2
ITAV_HUMAN Integrin alpha-V
4cak[4] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 71.4
/30.9
7
/10
ITA2B_HUMAN Integrin alpha-IIb
5ner[1] O NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
E 0.0
/32.4
3
/3
ITAV_HUMAN Integrin alpha-V
6mk0[1] Y JUY
(2S)-2-[(1,3-benzothiazole-2-carbonyl)amino]-4-{[5..
A 14.3
/29.2
7
/8
ITAV_HUMAN Integrin alpha-V
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
1170 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6ndh[6] PA ZN
ZINC ION[1 atoms]
L 100.0
/29.2
5
/5
ITA2_HUMAN Integrin alpha-2
3eob[2] G ZN
ZINC ION[1 atoms]
C 100.0
/100.0
6
/6
ITAL_HUMAN Integrin alpha-L
3nif[55] P CA
CALCIUM ION[1 atoms]
A 40.0
/38.3
5
/5
ITA2B_HUMAN Integrin alphaIIB beta3
3zdy[55] OA CA
CALCIUM ION[1 atoms]
C 40.0
/38.0
5
/5
ITA2B_HUMAN INTEGRIN ALPHA-IIB
3k71[25] MA CA
CALCIUM ION[1 atoms]
E 71.4
/37.4
7
/7
ITAX_HUMAN Integrin alpha-X
3k72[25] N CA
CALCIUM ION[1 atoms]
A 75.0
/37.7
8
/8
ITAX_HUMAN Integrin alpha-X
5ffo[25] HA CA
CALCIUM ION[1 atoms]
E 40.0
/32.8
5
/5
ITAV_HUMAN Integrin alpha-V
3zdx[47] T CA
CALCIUM ION[1 atoms]
A 60.0
/38.3
5
/5
ITA2B_HUMAN INTEGRIN ALPHA-IIB
3zdx[55] R CA
CALCIUM ION[1 atoms]
A 25.0
/38.3
4
/5
ITA2B_HUMAN INTEGRIN ALPHA-IIB
5ffo[25] IA CA
CALCIUM ION[1 atoms]
E 0.0
/32.8
6
/6
ITAV_HUMAN Integrin alpha-V
4wk2[8] L CA
CALCIUM ION[1 atoms]
A 50.0
/35.3
6
/6
ITA5_HUMAN Integrin alpha-5
5es4[18] MA CA
CALCIUM ION[1 atoms]
C 80.0
/37.5
5
/5
ITAX_HUMAN Integrin alpha-X
5hj2[15] H CA
CALCIUM ION[1 atoms]
B 100.0
/30.2
2
/2
ITA2_HUMAN Integrin alpha-2
6om1[25] KB CA
CALCIUM ION[1 atoms]
E 66.7
/31.9
6
/6
ITAV_HUMAN Integrin alpha-V
1jv2[6] P CA
CALCIUM ION[1 atoms]
A 66.7
/29.2
6
/6
INTEGRIN, ALPHA V
6nd9[6] SA CA
CALCIUM ION[1 atoms]
O 100.0
/29.2
5
/5
ITA2_HUMAN Integrin alpha-2
5ffo[31] W CA
CALCIUM ION[1 atoms]
A 40.0
/32.8
5
/5
ITAV_HUMAN Integrin alpha-V
5e6s[5] BA CA
CALCIUM ION[1 atoms]
E 100.0
/99.8
5
/5
ITAL_HUMAN Integrin alpha-L
3v4p[5] M CA
CALCIUM ION[1 atoms]
A 40.0
/34.7
5
/5
ITA4_HUMAN Integrin alpha-4
3v4v[5] L CA
CALCIUM ION[1 atoms]
A 66.7
/34.7
6
/6
ITA4_HUMAN Integrin alpha-4
3fcs[2] DA CA
CALCIUM ION[1 atoms]
C 75.0
/30.9
4
/4
Q17R67_HUMAN Integrin, alpha 2b
6bxf[3] G CA
CALCIUM ION[1 atoms]
A 100.0
/99.4
6
/6
ITB3_HUMAN ITAL_HUMAN ITB3_HUMAN Chimera protein of Integrin beta-3 and Integrin al..
3ppv[1] C CA
CALCIUM ION[1 atoms]
A 60.0
/25.7
5
/5
VWF_HUMAN von Willebrand factor
6v4p[1] F CA
CALCIUM ION[1 atoms]
A 40.0
/37.7
5
/5
ITA2B_HUMAN Integrin alpha-IIb
6v4p[1] G CA
CALCIUM ION[1 atoms]
A 60.0
/37.7
5
/5
ITA2B_HUMAN Integrin alpha-IIb
6v4p[1] H CA
CALCIUM ION[1 atoms]
A 40.0
/37.7
5
/5
ITA2B_HUMAN Integrin alpha-IIb
3zqk[1] F CA
CALCIUM ION[1 atoms]
A 60.0
/24.5
5
/5
VWF_HUMAN VON WILLEBRAND FACTOR
1m1u[1] B CA
CALCIUM ION[1 atoms]
A 100.0
/34.9
3
/3
ITAM_HUMAN Integrin alpha-M
5thp[8] OB MG
MAGNESIUM ION[1 atoms]
I 100.0
/29.2
5
/5
ITA2_HUMAN Integrin alpha-2
1xuo[17] E MG
MAGNESIUM ION[1 atoms]
B 100.0
/99.4
3
/3
ITAL_HUMAN Integrin alpha-L
1pt6[17] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/28.8
3
/3
ITA1_HUMAN Integrin alpha-1
5es4[5] CA MG
MAGNESIUM ION[1 atoms]
A 100.0
/37.7
4
/4
ITAX_HUMAN Integrin alpha-X
1cqp[21] E MG
MAGNESIUM ION[1 atoms]
B 100.0
/99.5
3
/3
ITAL_HUMAN ANTIGEN CD11A (P180)
1n9z[1] B MG
MAGNESIUM ION[1 atoms]
A 0.0
/34.5
4
/4
ITAM_HUMAN Integrin alpha-M
6bxj[1] C MG
MAGNESIUM ION[1 atoms]
A 0.0
/99.4
1
/1
ITB3_HUMAN ITAL_HUMAN ITB3_HUMAN Chimera protein of Integrin beta-3 and Integrin al..
5e6r[7] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/99.8
5
/5
ITAL_HUMAN Integrin alpha-L
6bxb[4] H MG
MAGNESIUM ION[1 atoms]
B 100.0
/99.4
5
/5
ITB3_HUMAN ITAL_HUMAN ITB3_HUMAN Chimera protein of Integrin beta-3 and Integrin al..
4nen[2] P MG
MAGNESIUM ION[1 atoms]
A 100.0
/37.6
1
/1
ITAX_HUMAN Integrin alpha-X
2vc2[1] G MG
MAGNESIUM ION[1 atoms]
A 0.0
/37.7
1
/1
ITA2B_HUMAN INTEGRIN ALPHA-IIB
2b2x[2] H MG
MAGNESIUM ION[1 atoms]
D 100.0
/31.9
5
/5
ITA1_RAT Integrin alpha-1
6nda[6] PA CD
CADMIUM ION[1 atoms]
L 100.0
/29.2
5
/5
ITA2_HUMAN Integrin alpha-2
1bhq[2] E CD
CADMIUM ION[1 atoms]
B 100.0
/35.9
4
/4
ITAM_HUMAN CD11B
1bhq[1] F CD
CADMIUM ION[1 atoms]
A 0.0
/35.9
1
/1
ITAM_HUMAN CD11B
4g1e[2] DA NI
NICKEL (II) ION[1 atoms]
A 0.0
/29.2
1
/3
ITAV_HUMAN Integrin alpha-V
4m76[1] D NI
NICKEL (II) ION[1 atoms]
B 100.0
/35.1
3
/3
ITAM_HUMAN Integrin alpha-M
6nde[6] JA PR
PRASEODYMIUM ION[1 atoms]
I 100.0
/29.2
4
/4
ITA2_HUMAN Integrin alpha-2
6ndb[6] PA CO
COBALT (II) ION[1 atoms]
L 100.0
/29.2
5
/5
ITA2_HUMAN Integrin alpha-2
1dzi[1] E CO
COBALT (II) ION[1 atoms]
A 100.0
/29.2
4
/4
ITA2_HUMAN INTEGRIN
6nd8[6] V BA
BARIUM ION[1 atoms]
C 100.0
/29.2
5
/5
ITA2_HUMAN Integrin alpha-2
6nd8[18] BB CL
CHLORIDE ION[1 atoms]
R 0.0
/29.2
1
/1
ITA2_HUMAN Integrin alpha-2
5thp[1] JC CL
CHLORIDE ION[1 atoms]
O 50.0
/29.4
2
/2
ITA2_HUMAN Integrin alpha-2
5hj2[1] J CL
CHLORIDE ION[1 atoms]
B 0.0
/30.2
2
/2
ITA2_HUMAN Integrin alpha-2
6nda[13] X CL
CHLORIDE ION[1 atoms]
C 0.0
/29.2
1
/1
ITA2_HUMAN Integrin alpha-2
5thp[2] RB CL
CHLORIDE ION[1 atoms]
I 0.0
/29.2
2
/2
ITA2_HUMAN Integrin alpha-2
3t3p[4] CA CL
CHLORIDE ION[1 atoms]
C 100.0
/38.0
1
/1
ITA2B_HUMAN Integrin alpha-IIb
1zop[6] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
ITAL_HUMAN I-DOMAIN FRAGMENT OF LFA-1
4um8[1] EA CL
CHLORIDE ION[1 atoms]
C 0.0
/32.3
3
/3
ITAV_HUMAN INTEGRIN ALPHA-V
5thp[1] QC CL
CHLORIDE ION[1 atoms]
O 33.3
/29.4
3
/3
ITA2_HUMAN Integrin alpha-2
4bj3[1] G CL
CHLORIDE ION[1 atoms]
A 0.0
/29.2
4
/5
ITA2_HUMAN INTEGRIN ALPHA-2
4g1e[2] AA CL
CHLORIDE ION[1 atoms]
A 0.0
/29.2
2
/2
ITAV_HUMAN Integrin alpha-V
5thp[2] PB CL
CHLORIDE ION[1 atoms]
I 0.0
/29.2
2
/2
ITA2_HUMAN Integrin alpha-2
5thp[1] CD CL
CHLORIDE ION[1 atoms]
R 0.0
/29.3
2
/2
ITA2_HUMAN Integrin alpha-2
3q3g[1] PA CL
CHLORIDE ION[1 atoms]
F 33.3
/35.6
3
/3
ITAM_HUMAN Integrin alpha-M
3q3g[2] BA CL
CHLORIDE ION[1 atoms]
C 50.0
/35.6
2
/3
ITAM_HUMAN Integrin alpha-M
5hj2[1] I CL
CHLORIDE ION[1 atoms]
B 0.0
/30.2
2
/2
ITA2_HUMAN Integrin alpha-2
5e6u[3] F CL
CHLORIDE ION[1 atoms]
A 100.0
/99.8
3
/3
ITAL_HUMAN Integrin alpha-L
5thp[1] BC CL
CHLORIDE ION[1 atoms]
L 0.0
/29.3
1
/1
ITA2_HUMAN Integrin alpha-2
3t3m[1] DA CL
CHLORIDE ION[1 atoms]
C 0.0
/38.0
2
/2
ITA2B_HUMAN Integrin alpha-IIb
5thp[1] DA CL
CHLORIDE ION[1 atoms]
C 100.0
/28.9
1
/1
ITA2_HUMAN Integrin alpha-2
5hj2[1] N CL
CHLORIDE ION[1 atoms]
C 0.0
/30.2
3
/3
ITA2_HUMAN Integrin alpha-2
6ndf[6] JA SR
STRONTIUM ION[1 atoms]
I 100.0
/29.2
5
/5
ITA2_HUMAN Integrin alpha-2
6ndg[6] PA Y1
YTTRIUM ION[1 atoms]
L 100.0
/29.2
5
/5
ITA2_HUMAN Integrin alpha-2
6ndc[6] DA CR
CHROMIUM ION[1 atoms]
F 100.0
/29.2
5
/5
ITA2_HUMAN Integrin alpha-2
6ndd[6] IA MN
MANGANESE (II) ION[1 atoms]
I 100.0
/29.2
5
/5
ITA2_HUMAN Integrin alpha-2
1m1x[10] L MN
MANGANESE (II) ION[1 atoms]
A 0.0
/29.2
5
/5
Integrin alpha-V
1m1x[10] N MN
MANGANESE (II) ION[1 atoms]
A 50.0
/29.2
6
/6
Integrin alpha-V
1mhp[4] G MN
MANGANESE (II) ION[1 atoms]
A 100.0
/31.6
5
/5
ITA1_RAT integrin alpha 1, (RESIDUES 169-360)
1jlm[2] B MN
MANGANESE (II) ION[1 atoms]
A 100.0
/35.0
4
/4
ITAM_HUMAN INTEGRIN
6mk0[10] Q MN
MANGANESE (II) ION[1 atoms]
A 40.0
/29.2
5
/5
ITAV_HUMAN Integrin alpha-V
1zop[5] E MN
MANGANESE (II) ION[1 atoms]
B 100.0
/100.0
5
/5
ITAL_HUMAN I-DOMAIN FRAGMENT OF LFA-1
4mmx[10] Q MN
MANGANESE (II) ION[1 atoms]
A 40.0
/29.2
5
/5
ITAV_HUMAN Integrin alpha-V
6msu[9] T MN
MANGANESE (II) ION[1 atoms]
A 75.0
/29.2
4
/4
ITAV_HUMAN Integrin alpha-V
5thp[2] NB NA
SODIUM ION[1 atoms]
I 60.0
/29.2
5
/5
ITA2_HUMAN Integrin alpha-2
6ndg[62] FA NA
SODIUM ION[1 atoms]
F 50.0
/29.2
4
/4
ITA2_HUMAN Integrin alpha-2
4neh[1] O NA
SODIUM ION[1 atoms]
A 75.0
/37.6
4
/4
ITAX_HUMAN Integrin alpha-X
4g1m[1] V NA
SODIUM ION[1 atoms]
A 25.0
/29.2
4
/4
ITAV_HUMAN Integrin alpha-V
5thp[2] Y NA
SODIUM ION[1 atoms]
C 0.0
/28.9
1
/1
ITA2_HUMAN Integrin alpha-2
5thp[1] GA NA
SODIUM ION[1 atoms]
C 100.0
/28.9
1
/2
ITA2_HUMAN Integrin alpha-2
4mmz[1] T NA
SODIUM ION[1 atoms]
A 0.0
/29.2
3
/4
ITAV_HUMAN Integrin alpha-V
5thp[1] AD NA
SODIUM ION[1 atoms]
R 0.0
/29.3
1
/1
ITA2_HUMAN Integrin alpha-2
5thp[1] WC NA
SODIUM ION[1 atoms]
R 100.0
/29.3
1
/1
ITA2_HUMAN Integrin alpha-2
5thp[2] OC NA
SODIUM ION[1 atoms]
O 33.3
/29.4
3
/3
ITA2_HUMAN Integrin alpha-2
3ppy[2] B NA
SODIUM ION[1 atoms]
A 100.0
/26.5
4
/4
VWF_HUMAN von Willebrand factor
5thp[1] X NA
SODIUM ION[1 atoms]
C 50.0
/28.9
2
/3
ITA2_HUMAN Integrin alpha-2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
1170 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3fcu[3] H alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. C 0.0
/37.7
2
/2
Q17R67_HUMAN Integrin, alpha 2b
5nem[1] J alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. E 33.3
/32.5
9
/9
ITAV_HUMAN Integrin alpha-V
5net[2] J alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. E 33.3
/32.4
9
/9
ITAV_HUMAN Integrin alpha-V
4z7n[17] M alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. C 0.0
/38.0
2
/2
ITA2B_HUMAN Integrin alpha-IIb
6om1[11] DA alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. G 25.0
/31.7
8
/8
ITAV_HUMAN Integrin alpha-V
5es4[1] N alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. C 33.3
/37.5
3
/5
ITAX_HUMAN Integrin alpha-X
5es4[1] S alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. E 12.5
/37.5
8
/8
ITAX_HUMAN Integrin alpha-X
3v4v[4] I alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 0.0
/34.7
5
/5
ITA4_HUMAN Integrin alpha-4
4wk4[1] E alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 25.0
/34.8
4
/4
ITA5_HUMAN Integrin alpha-5
5es4[1] J alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. A 16.7
/37.7
12
/14
ITAX_HUMAN Integrin alpha-X
4um8[1] I alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. A 0.0
/31.7
1
/2
ITAV_HUMAN INTEGRIN ALPHA-V
5es4[1] I alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. A 50.0
/37.7
2
/2
ITAX_HUMAN Integrin alpha-X
3k71[1] T alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. G 0.0
/37.7
4
/4
ITAX_HUMAN Integrin alpha-X
3fcu[12] G alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 0.0
/38.3
2
/2
Q17R67_HUMAN Integrin, alpha 2b
3k72[5] J alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 0.0
/37.4
4
/4
ITAX_HUMAN Integrin alpha-X
3k72[3] H alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 20.0
/37.7
5
/5
ITAX_HUMAN Integrin alpha-X
3k71[4] Q alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. E 20.0
/37.4
5
/5
ITAX_HUMAN Integrin alpha-X
3nid[6] K alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. C 0.0
/38.0
2
/2
ITA2B_HUMAN Integrin alpha-IIb
3k71[8] K alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 66.7
/37.4
3
/4
ITAX_HUMAN Integrin alpha-X
5nem[1] H alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. E 0.0
/32.5
3
/6
ITAV_HUMAN Integrin alpha-V
5nem[1] G alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. E 25.0
/32.5
4
/4
ITAV_HUMAN Integrin alpha-V
5net[1] H alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. E 0.0
/32.4
3
/6
ITAV_HUMAN Integrin alpha-V
4g1m[1] E alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 0.0
/29.2
7
/8
ITAV_HUMAN Integrin alpha-V
4neh[1] E alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 18.2
/37.6
11
/11
ITAX_HUMAN Integrin alpha-X
4wk2[13] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/35.3
3
/3
ITA5_HUMAN Integrin alpha-5
1m1x[4] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/29.2
7
/8
Integrin alpha-V
4wk2[4] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 20.0
/35.3
5
/5
ITA5_HUMAN Integrin alpha-5
4neh[2] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/37.6
4
/4
ITAX_HUMAN Integrin alpha-X
3k6s[6] Q 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. E 50.0
/37.5
4
/5
ITAX_HUMAN Integrin alpha-X
1jv2[19] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/29.2
4
/4
INTEGRIN, ALPHA V
6mk0[6] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/29.2
4
/4
ITAV_HUMAN Integrin alpha-V
4g1e[4] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/29.2
1
/1
ITAV_HUMAN Integrin alpha-V
3k6s[12] R 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. G 50.0
/37.5
2
/3
ITAX_HUMAN Integrin alpha-X
3gxb[2] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/25.7
4
/4
VWF_HUMAN von Willebrand factor
3k6s[2] M 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 0.0
/37.5
3
/3
ITAX_HUMAN Integrin alpha-X
4g1m[2] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/29.2
3
/3
ITAV_HUMAN Integrin alpha-V
4cak[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 28.6
/30.9
21
/21
ITA2B_HUMAN Integrin alpha-IIb
3fcs[1] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 0.0
/30.9
2
/2
Q17R67_HUMAN Integrin, alpha 2b
3fcs[1] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 0.0
/30.9
1
/2
Q17R67_HUMAN Integrin, alpha 2b
6om2[1] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 33.3
/32.4
3
/5
ITAV_HUMAN Integrin alpha-V
4nen[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/37.6
2
/2
ITAX_HUMAN Integrin alpha-X
5es4[1] O alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. C 12.5
/37.5
8
/8
ITAX_HUMAN Integrin alpha-X
5es4[1] Y alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. G 50.0
/37.5
2
/2
ITAX_HUMAN Integrin alpha-X
5es4[1] W alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. G 11.1
/37.5
9
/9
ITAX_HUMAN Integrin alpha-X
1tye[2] G beta-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(.. A 0.0
/37.2
3
/3
ITAB_HUMAN Integrin alpha-IIb
1tye[1] H beta-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-.. C 0.0
/37.2
2
/2
ITAB_HUMAN Integrin alpha-IIb
4um8[8] M alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. C 0.0
/32.3
5
/9
ITAV_HUMAN INTEGRIN ALPHA-V
4wjk[7] C alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. A 0.0
/35.3
5
/10
ITA5_HUMAN Integrin alpha-5
3ze2[1] K alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. A 0.0
/38.3
2
/2
ITA2B_HUMAN INTEGRIN ALPHA-IIB
4nen[1] E alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. A 18.2
/37.6
11
/11
ITAX_HUMAN Integrin alpha-X
4um8[1] O alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 0.0
/32.3
2
/2
ITAV_HUMAN INTEGRIN ALPHA-V
5ffo[2] K alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 0.0
/32.8
6
/10
ITAV_HUMAN Integrin alpha-V
6om2[1] O alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 11.1
/32.4
9
/9
ITAV_HUMAN Integrin alpha-V
6om2[1] H alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 16.7
/32.4
6
/6
ITAV_HUMAN Integrin alpha-V
4wk2[1] D alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 0.0
/35.3
5
/10
ITA5_HUMAN Integrin alpha-5
6om2[1] H alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 20.0
/32.4
5
/5
ITAV_HUMAN Integrin alpha-V
5es4[1] R alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. E 50.0
/37.5
4
/5
ITAX_HUMAN Integrin alpha-X
6om1[2] W alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. E 0.0
/31.9
5
/8
ITAV_HUMAN Integrin alpha-V
5ffo[2] J alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. A 14.3
/32.8
7
/8
ITAV_HUMAN Integrin alpha-V
6uja[3] D alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 0.0
/32.4
5
/9
ITAV_HUMAN Integrin alpha-V
3t3m[8] I alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 0.0
/38.3
3
/3
ITA2B_HUMAN Integrin alpha-IIb
6om1[1] X alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. E 0.0
/31.9
6
/6
ITAV_HUMAN Integrin alpha-V
5es4[1] V alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. G 50.0
/37.5
2
/3
ITAX_HUMAN Integrin alpha-X
5es4[1] U alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. E 25.0
/37.5
4
/4
ITAX_HUMAN Integrin alpha-X
5es4[1] Q alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 40.0
/37.5
5
/5
ITAX_HUMAN Integrin alpha-X
6om2[1] I alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 0.0
/32.4
6
/10
ITAV_HUMAN Integrin alpha-V
5ffg[1] G alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 0.0
/32.4
2
/3
ITAV_HUMAN Integrin alpha-V
4mmz[11] I beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/29.2
3
/3
ITAV_HUMAN Integrin alpha-V
4neh[1] D beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/37.6
3
/3
ITAX_HUMAN Integrin alpha-X
4um9[3] O beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 42.9
/32.3
7
/7
ITAV_HUMAN INTEGRIN ALPHA-V
4wjk[5] D beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/35.3
4
/5
ITA5_HUMAN Integrin alpha-5
4z7q[1] M beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 0.0
/38.0
3
/3
ITA2B_HUMAN Integrin alpha-IIb
4wk4[1] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 20.0
/34.8
5
/5
ITA5_HUMAN Integrin alpha-5
4irz[1] D beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/34.4
8
/8
Integrin alpha4 subunit
5es4[1] L beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 25.0
/37.7
4
/4
ITAX_HUMAN Integrin alpha-X
4cak[1] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/30.9
3
/3
ITA2B_HUMAN Integrin alpha-IIb
5ner[2] K alpha-D-mannopyranose-(1-4)-alpha-D-mannopyranose-.. E 0.0
/32.4
1
/6
ITAV_HUMAN Integrin alpha-V
5nem[1] K alpha-D-mannopyranose-(1-4)-alpha-D-mannopyranose-.. E 0.0
/32.5
1
/6
ITAV_HUMAN Integrin alpha-V
3ije[2] E alpha-D-mannopyranose-(1-4)-alpha-D-mannopyranose-.. A 0.0
/29.2
8
/9
ITAV_HUMAN Integrin alpha-V
4um8[1] Q alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. C 33.3
/32.3
3
/4
ITAV_HUMAN INTEGRIN ALPHA-V
5es4[3] T alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. E 60.0
/37.5
5
/6
ITAX_HUMAN Integrin alpha-X
5ffo[2] L alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. A 22.2
/32.8
9
/9
ITAV_HUMAN Integrin alpha-V
4um9[1] H alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. A 20.0
/32.4
5
/5
ITAV_HUMAN INTEGRIN ALPHA-V
6om1[1] CA alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. G 0.0
/31.7
4
/7
ITAV_HUMAN Integrin alpha-V
6om1[1] BA alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. G 12.5
/31.7
8
/8
ITAV_HUMAN Integrin alpha-V
5es4[1] P alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. C 60.0
/37.5
5
/6
ITAX_HUMAN Integrin alpha-X
4um8[1] F alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. A 14.3
/31.7
7
/7
ITAV_HUMAN INTEGRIN ALPHA-V
3fcs[1] I alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 0.0
/30.9
2
/3
Q17R67_HUMAN Integrin, alpha 2b
4g1e[2] E alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 12.5
/29.2
8
/9
ITAV_HUMAN Integrin alpha-V
4mmz[7] E alpha-D-mannopyranose-(1-4)-beta-D-mannopyranose-(.. A 0.0
/29.2
6
/7
ITAV_HUMAN Integrin alpha-V
1m1x[4] H 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-.. A 0.0
/29.2
3
/3
Integrin alpha-V
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1170 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5e6s[1] A ITAL_HUMAN Integrin alpha-L[579 aa] C 100.0
/99.8
6
/6
ITAL_HUMAN Integrin alpha-L
5e6s[2] E ITAL_HUMAN Integrin alpha-L[580 aa] C 100.0
/99.8
11
/11
ITAL_HUMAN Integrin alpha-L
5e6s[2] C ITAL_HUMAN Integrin alpha-L[578 aa] E 100.0
/99.8
19
/19
ITAL_HUMAN Integrin alpha-L
5e6s[1] C ITAL_HUMAN Integrin alpha-L[578 aa] A 100.0
/99.8
4
/4
ITAL_HUMAN Integrin alpha-L
3bqn[12] A ITAL_HUMAN Integrin alpha-L[182 aa] B 100.0
/99.5
14
/14
ITAL_HUMAN Integrin alpha-L
1lfa[1] A ITAL_HUMAN CD11A[183 aa] B 100.0
/100.0
7
/7
ITAL_HUMAN CD11A
1lfa[1] B ITAL_HUMAN CD11A[182 aa] A 100.0
/100.0
5
/5
ITAL_HUMAN CD11A
3k72[10] C ITAX_HUMAN Integrin alpha-X[882 aa] C 0.0
/37.4
3
/4
ITAX_HUMAN Integrin alpha-X
3k71[10] C ITAX_HUMAN Integrin alpha-X[884 aa] A 29.7
/37.4
37
/41
ITAX_HUMAN Integrin alpha-X
3k72[10] A ITAX_HUMAN Integrin alpha-X[884 aa] C 16.0
/37.4
25
/26
ITAX_HUMAN Integrin alpha-X
3k71[2] G ITAX_HUMAN Integrin alpha-X[1082 aa] E 29.7
/37.4
37
/41
ITAX_HUMAN Integrin alpha-X
3k6s[2] A ITAX_HUMAN Integrin alpha-X[1082 aa] G 0.0
/37.5
5
/7
ITAX_HUMAN Integrin alpha-X
3k71[2] G ITAX_HUMAN Integrin alpha-X[1082 aa] C 15.4
/37.7
26
/27
ITAX_HUMAN Integrin alpha-X
1idn[4] B ITAM_HUMAN CD11B[190 aa] A 50.0
/35.9
2
/4
ITAM_HUMAN CD11B
1bhq[2] A ITAM_HUMAN CD11B[189 aa] B 50.0
/35.9
2
/4
ITAM_HUMAN CD11B
6om2[1] A ITAV_HUMAN Integrin alpha-V[598 aa] C 0.0
/32.4
2
/2
ITAV_HUMAN Integrin alpha-V
6om2[1] C ITAV_HUMAN Integrin alpha-V[596 aa] A 0.0
/32.4
2
/2
ITAV_HUMAN Integrin alpha-V
4bj3[1] B ITA2_HUMAN INTEGRIN ALPHA-2[180 aa] A 0.0
/29.2
1
/1
ITA2_HUMAN INTEGRIN ALPHA-2
1aox[2] A ITA2_HUMAN INTEGRIN ALPHA 2 BETA[201 aa] B 100.0
/28.3
1
/5
ITA2_HUMAN INTEGRIN ALPHA 2 BETA
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
1170 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3nif[1] T GOL
GLYCEROL[6 atoms]
A 28.6
/38.3
7
/7
ITA2B_HUMAN Integrin alphaIIB beta3
4mmz[2] U GOL
GLYCEROL[6 atoms]
A 0.0
/29.2
2
/2
ITAV_HUMAN Integrin alpha-V
3nif[3] S GOL
GLYCEROL[6 atoms]
A 0.0
/38.3
4
/4
ITA2B_HUMAN Integrin alphaIIB beta3
5hj2[1] U GOL
GLYCEROL[6 atoms]
F 0.0
/30.2
2
/2
ITA2_HUMAN Integrin alpha-2
4z7q[6] V GOL
GLYCEROL[6 atoms]
A 0.0
/38.3
3
/3
ITA2B_HUMAN Integrin alpha-IIb
3zdx[2] N GOL
GLYCEROL[6 atoms]
A 0.0
/38.3
1
/3
ITA2B_HUMAN INTEGRIN ALPHA-IIB
1pt6[1] F GOL
GLYCEROL[6 atoms]
B 16.7
/28.3
6
/6
ITA1_HUMAN Integrin alpha-1
3qa3[3] T GOL
GLYCEROL[6 atoms]
C 20.0
/34.9
5
/5
ITAM_HUMAN Integrin alpha-M
3nif[2] U GOL
GLYCEROL[6 atoms]
A 100.0
/38.3
1
/4
ITA2B_HUMAN Integrin alphaIIB beta3
3f78[1] E GOL
GLYCEROL[6 atoms]
A 100.0
/99.4
4
/4
ITAL_HUMAN Integrin alpha-L
4cn9[1] F GOL
GLYCEROL[6 atoms]
A 25.0
/30.3
4
/4
Q8T5C2_MYTGA PROXIMAL THREAD MATRIX PROTEIN 1
3f74[3] E GOL
GLYCEROL[6 atoms]
B 100.0
/99.4
2
/2
ITAL_HUMAN Integrin alpha-L
3nif[2] R GOL
GLYCEROL[6 atoms]
A 0.0
/38.3
3
/3
ITA2B_HUMAN Integrin alphaIIB beta3
5thp[1] VC GOL
GLYCEROL[6 atoms]
R 0.0
/29.3
1
/1
ITA2_HUMAN Integrin alpha-2
3f78[1] H GOL
GLYCEROL[6 atoms]
B 100.0
/99.4
3
/3
ITAL_HUMAN Integrin alpha-L
3f78[1] J GOL
GLYCEROL[6 atoms]
C 100.0
/99.4
4
/4
ITAL_HUMAN Integrin alpha-L
3qa3[1] S GOL
GLYCEROL[6 atoms]
C 0.0
/34.9
3
/4
ITAM_HUMAN Integrin alpha-M
6bxf[1] C GOL
GLYCEROL[6 atoms]
A 100.0
/99.4
3
/3
ITB3_HUMAN ITAL_HUMAN ITB3_HUMAN Chimera protein of Integrin beta-3 and Integrin al..
3zqk[1] E GOL
GLYCEROL[6 atoms]
A 50.0
/24.5
4
/4
VWF_HUMAN VON WILLEBRAND FACTOR
6bxb[1] G GOL
GLYCEROL[6 atoms]
A 100.0
/99.4
5
/5
ITB3_HUMAN ITAL_HUMAN ITB3_HUMAN Chimera protein of Integrin beta-3 and Integrin al..
3ze2[1] AA GOL
GLYCEROL[6 atoms]
C 33.3
/38.0
3
/3
ITA2B_HUMAN INTEGRIN ALPHA-IIB
3nid[1] V GOL
GLYCEROL[6 atoms]
A 100.0
/38.3
2
/2
ITA2B_HUMAN Integrin alpha-IIb
6nd8[20] AB SO4
SULFATE ION[5 atoms]
R 0.0
/29.2
3
/4
ITA2_HUMAN Integrin alpha-2
3zdx[12] P SO4
SULFATE ION[5 atoms]
A 50.0
/38.3
2
/3
ITA2B_HUMAN INTEGRIN ALPHA-IIB
3t3m[13] S SO4
SULFATE ION[5 atoms]
A 0.0
/38.3
3
/3
ITA2B_HUMAN Integrin alpha-IIb
3nid[4] KA SO4
SULFATE ION[5 atoms]
C 28.6
/38.0
7
/7
ITA2B_HUMAN Integrin alpha-IIb
6ndg[68] OA SO4
SULFATE ION[5 atoms]
L 66.7
/29.2
3
/3
ITA2_HUMAN Integrin alpha-2
3t3p[19] BA SO4
SULFATE ION[5 atoms]
C 0.0
/38.0
4
/4
ITA2B_HUMAN Integrin alpha-IIb
4z7o[6] O SO4
SULFATE ION[5 atoms]
A 0.0
/38.3
3
/3
ITA2B_HUMAN Integrin alpha-IIb
4um9[1] R SO4
SULFATE ION[5 atoms]
A 0.0
/32.4
3
/7
ITAV_HUMAN INTEGRIN ALPHA-V
4cnb[4] F SO4
SULFATE ION[5 atoms]
B 20.0
/30.1
5
/5
Q8T5C2_MYTGA PROXIMAL THREAD MATRIX PROTEIN 1
4g1e[2] Y SO4
SULFATE ION[5 atoms]
A 100.0
/29.2
1
/3
ITAV_HUMAN Integrin alpha-V
4um9[1] FA SO4
SULFATE ION[5 atoms]
C 0.0
/32.3
3
/3
ITAV_HUMAN INTEGRIN ALPHA-V
4g1e[2] GA SO4
SULFATE ION[5 atoms]
A 0.0
/29.2
1
/1
ITAV_HUMAN Integrin alpha-V
5hj2[1] R SO4
SULFATE ION[5 atoms]
D 0.0
/28.3
1
/1
ITA2_HUMAN Integrin alpha-2
4um8[1] U SO4
SULFATE ION[5 atoms]
A 100.0
/31.7
2
/2
ITAV_HUMAN INTEGRIN ALPHA-V
3zdx[2] FA SO4
SULFATE ION[5 atoms]
C 25.0
/38.0
4
/4
ITA2B_HUMAN INTEGRIN ALPHA-IIB
4cn8[1] D SO4
SULFATE ION[5 atoms]
A 33.3
/29.3
3
/3
Q8T5C2_MYTGA PROXIMAL THREAD MATRIX PROTEIN 1
4g1e[3] W SO4
SULFATE ION[5 atoms]
A 33.3
/29.2
3
/4
ITAV_HUMAN Integrin alpha-V
3hi6[1] I SO4
SULFATE ION[5 atoms]
B 100.0
/98.3
1
/1
ITAL_HUMAN Integrin alpha-L
4um9[2] Q SO4
SULFATE ION[5 atoms]
A 50.0
/32.4
2
/2
ITAV_HUMAN INTEGRIN ALPHA-V
4cn8[1] E SO4
SULFATE ION[5 atoms]
A 0.0
/29.3
2
/2
Q8T5C2_MYTGA PROXIMAL THREAD MATRIX PROTEIN 1
4um8[1] T SO4
SULFATE ION[5 atoms]
A 0.0
/31.7
3
/3
ITAV_HUMAN INTEGRIN ALPHA-V
6rhw[12] H DMS
DIMETHYL SULFOXIDE[4 atoms]
C 0.0
/35.3
1
/1
ITAM_HUMAN Integrin alpha-M
1bhq[2] D ACE
ACETYL GROUP[3 atoms]
A 50.0
/35.9
4
/5
ITAM_HUMAN CD11B
3v4p[1] DA TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
C 0.0
/34.7
2
/2
ITA4_HUMAN Integrin alpha-4
5ffg[1] N MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 25.0
/32.4
4
/7
ITAV_HUMAN Integrin alpha-V
6om2[1] HA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
C 16.7
/32.4
6
/6
ITAV_HUMAN Integrin alpha-V
4irz[1] L PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/34.4
1
/4
Integrin alpha4 subunit
6om2[2] Z PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 50.0
/32.4
2
/2
ITAV_HUMAN Integrin alpha-V
5hj2[1] K PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 33.3
/30.2
3
/3
ITA2_HUMAN Integrin alpha-2
3fcs[1] HA IMD
IMIDAZOLE[5 atoms]
C 33.3
/30.9
3
/4
Q17R67_HUMAN Integrin, alpha 2b
3fcs[2] V IMD
IMIDAZOLE[5 atoms]
A 0.0
/30.9
5
/5
Q17R67_HUMAN Integrin, alpha 2b
3fcs[1] GA IMD
IMIDAZOLE[5 atoms]
C 0.0
/30.9
4
/4
Q17R67_HUMAN Integrin, alpha 2b
3fcs[1] KA IMD
IMIDAZOLE[5 atoms]
C 33.3
/30.9
3
/4
Q17R67_HUMAN Integrin, alpha 2b
3fcs[1] JA IMD
IMIDAZOLE[5 atoms]
C 33.3
/30.9
3
/3
Q17R67_HUMAN Integrin, alpha 2b
4cn9[3] K EDO
1,2-ETHANEDIOL[4 atoms]
B 14.3
/30.3
7
/7
Q8T5C2_MYTGA PROXIMAL THREAD MATRIX PROTEIN 1
3qa3[1] P EDO
1,2-ETHANEDIOL[4 atoms]
C 33.3
/34.9
3
/3
ITAM_HUMAN Integrin alpha-M
6om1[1] BC EDO
1,2-ETHANEDIOL[4 atoms]
G 33.3
/31.7
3
/3
ITAV_HUMAN Integrin alpha-V
3q3g[1] MA EDO
1,2-ETHANEDIOL[4 atoms]
F 0.0
/35.6
2
/3
ITAM_HUMAN Integrin alpha-M
3q3g[1] IB EDO
1,2-ETHANEDIOL[4 atoms]
L 40.0
/35.6
5
/6
ITAM_HUMAN Integrin alpha-M
6om1[3] ZA EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/31.8
1
/1
ITAV_HUMAN Integrin alpha-V
3q3g[1] NA EDO
1,2-ETHANEDIOL[4 atoms]
F 0.0
/35.6
2
/2
ITAM_HUMAN Integrin alpha-M
3q3g[2] QA EDO
1,2-ETHANEDIOL[4 atoms]
I 66.7
/35.6
3
/3
ITAM_HUMAN Integrin alpha-M
3q3g[1] HB EDO
1,2-ETHANEDIOL[4 atoms]
L 20.0
/35.6
5
/5
ITAM_HUMAN Integrin alpha-M
4cn8[1] C EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/29.3
4
/4
Q8T5C2_MYTGA PROXIMAL THREAD MATRIX PROTEIN 1
4o02[2] R NO3
NITRATE ION[4 atoms]
A 0.0
/29.2
2
/6
ITAV_HUMAN Integrin alpha-V
3m6f[1] C NO3
NITRATE ION[4 atoms]
A 100.0
/100.0
3
/3
ITAL_HUMAN Integrin alpha-L
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.