[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
37022 1255 479 P59594(SPIKE_CVHSA) RecName: Full=Spike glycoprotein {ECO:0000255|HAMAP-Rule:MF_04099}; Short=S glycoprotein {ECO:0000255|HAMAP-Rule:MF_04099};AltName: Full=E2 {ECO:0000255|HAMAP-Rule:MF_04099};AltName: Full=Peplomer protein {ECO:0000255|HAMAP-Rule:MF_04099};Contains: RecName: Full=Spike protein S1 {ECO:0000255|HAMAP-Rule:MF_04099};Contains: RecName: Full=Spike protein S2 {ECO:0000255|HAMAP-Rule:MF_04099};Contains: RecName: Full=Spike protein S2' {ECO:0000255|HAMAP-Rule:MF_04099};Flags: Precursor;
QUERYSEQ
MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHT
MIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSPAQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIY
QTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRP
FERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCSFGGVSVITPGTNASSEVAVLYQD
VNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDCNMYICGDSTECANLLLQYGSFCTQLNRALS
GIAAEQDRNTREVFAQVKQMYKTPTLKYFGGFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYE
NQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAPHGVVFLHVTYV
PSQERNFTTAPAICHEGKAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWL
GFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59594(SPIKE_CVHSA)]

1255
region name description
1-13 SIGNAL
14-1255 CHAIN /note="Spike glycoprotein" /id="PRO_0000037208"
14-667 CHAIN /note="Spike protein S1" /id="PRO_0000037209"
668-1255 CHAIN /note="Spike protein S2" /id="PRO_0000037210"
798-1255 CHAIN /note="Spike protein S2'" /id="PRO_0000444082"
14-1195 TOPO_DOM /note="Extracellular"
1196-1216 TRANSMEM /note="Helical"
1217-1255 TOPO_DOM /note="Cytoplasmic"
14-290 DOMAIN /note="BetaCoV S1-NTD"
321-513 DOMAIN /note="BetaCoV S1-CTD"
306-527 REGION /note="Receptor-binding domain"
424-494 REGION /note="Receptor-binding motif; binding to human ACE2"
770-788 REGION /note="Fusion peptide"
902-952 REGION /note="Heptad repeat 1"
1145-1184 REGION /note="Heptad repeat 2"
931-975 COILED
1157-1185 COILED
1217-1236 COMPBIAS /note="Cys-rich"
1-1255 DISORDER predicted by DISOPRED (1-26,665-674,1003-1003,1005-1006,1253-1255)

MONOMER
1255
pdb_id a1 identity[%]2 description
6cs2 B 99.7 SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6xr8 B 77.3 SPIKE_SARS2 Spike glycoprotein
6m3w B 100.0 SPIKE_CVHSA Spike glycoprotein
1wyy A 100.0 SPIKE_CVHSA E2 Glycoprotein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
1255 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3bgf[2] F F26G19 Fab[216 aa] B 100.0
/100.0
11
/11
SPIKE_CVHSA Spike protein S1
2beq[12] A SPIKE_CVHSA Spike glycoprotein[37 aa] F 100.0
/100.0
18
/18
SPIKE_CVHSA Spike glycoprotein
2beq[2] B SPIKE_CVHSA Spike glycoprotein[38 aa] F 100.0
/100.0
2
/2
SPIKE_CVHSA Spike glycoprotein
5zvm[6] E pan-CoV inhibitory peptide EK1[35 aa] C 100.0
/100.0
24
/24
SPIKE_CVHSA Spike glycoprotein
5zvm[6] D pan-CoV inhibitory peptide EK1[29 aa] A 100.0
/100.0
19
/19
SPIKE_CVHSA Spike glycoprotein
2bez[6] A SPIKE_CVHSA Spike glycoprotein[77 aa] B 100.0
/100.0
27
/27
SPIKE_CVHSA Spike glycoprotein
3bgf[2] E F26G19 Fab[210 aa] B 100.0
/100.0
6
/6
SPIKE_CVHSA Spike protein S1
2ghw[2] B Q65ZC9_HUMAN anti-sars scFv antibody, 80R[232 aa] A 100.0
/100.0
24
/24
SPIKE_CVHSA Spike glycoprotein
6waq[2] C nanobody SARS VHH-72[125 aa] B 100.0
/100.0
19
/19
SPIKE_CVHSA Spike glycoprotein
3d0i[14] A ACE2_PAGLA ACE2_HUMAN Angiotensin-converting enzyme 2[597 aa] C 88.9
/98.3
18
/18
SPIKE_CVHSA Spike glycoprotein
6ack[3] D ACE2_HUMAN Angiotensin-converting enzyme 2[597 aa] C 100.0
/100.0
13
/13
SPIKE_CVHSA Spike glycoprotein
6cs2[1] D ACE2_HUMAN Angiotensin-converting enzyme 2[544 aa] B 100.0
/99.7
19
/19
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6vw1[6] B ACE2_HUMAN Angiotensin-converting enzyme 2[596 aa] D 47.1
/86.0
17
/17
SPIKE_CVHSA SPIKE_SARS2 SPIKE_CVHSA SARS-CoV-2 chimeric RBD
2dd8[1] B Q8N355_HUMAN IGG Light Chain[212 aa] C 100.0
/100.0
8
/8
SPIKE_CVHSA Spike glycoprotein
2beq[15] E SPIKE_CVHSA Spike glycoprotein[47 aa] B 100.0
/100.0
16
/16
SPIKE_CVHSA Spike glycoprotein
1zv8[15] L VGL2_CVHSA E2 glycoprotein[34 aa] K 100.0
/100.0
20
/20
VGL2_CVHSA E2 glycoprotein
2beq[2] F SPIKE_CVHSA Spike glycoprotein[48 aa] B 100.0
/100.0
2
/3
SPIKE_CVHSA Spike glycoprotein
2dd8[1] A Q6PJF1_HUMAN IGG Heavy Chain[220 aa] C 100.0
/100.0
7
/7
SPIKE_CVHSA Spike glycoprotein
2dd8[1] A Q6PJF1_HUMAN IGG Heavy Chain[220 aa] C 100.0
/100.0
13
/13
SPIKE_CVHSA Spike glycoprotein
1zv8[12] C VGL2_CVHSA E2 glycoprotein[46 aa] B 100.0
/100.0
19
/19
VGL2_CVHSA E2 glycoprotein
6nb6[1] E S230 heavy chain[124 aa] B 100.0
/99.7
1
/1
SPIKE_CVHSA Spike glycoprotein
6nb6[1] D S230 heavy chain[123 aa] C 100.0
/99.7
1
/1
SPIKE_CVHSA Spike glycoprotein
6nb7[5] E S230 light chain[110 aa] B 100.0
/99.7
3
/3
SPIKE_CVHSA Spike glycoprotein
6wpt[4] E S309 neutralizing antibody light chain[99 aa] C 33.3
/80.6
3
/3
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6wps[5] H S309 neutralizing antibody heavy chain[123 aa] G 92.3
/80.5
13
/13
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6xcm[5] E C105 Fab Heavy Chain[116 aa] B 30.8
/79.6
13
/13
SPIKE_SARS2 Spike glycoprotein
6xcn[5] H C105 Fab Light Chain[111 aa] C 100.0
/79.6
3
/3
SPIKE_SARS2 Spike glycoprotein
6xey[3] I A0A5C2GJG2_HUMAN 2-4 Light Chain[108 aa] A 0.0
/77.6
3
/3
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6xc2[6] B CC12.1 light chain[215 aa] A 66.7
/74.5
12
/12
SPIKE_SARS2 Spike protein S1
6zer[8] F light chain[215 aa] D 92.3
/74.4
13
/13
SPIKE_SARS2 RBD
6zcz[1] D EY6A light chain[215 aa] A 92.3
/74.1
13
/13
SPIKE_SARS2 Spike glycoprotein
6zdg[3] C EY6A light chain[215 aa] D 90.9
/74.1
11
/11
SPIKE_SARS2 Spike glycoprotein
6zdh[3] E EY6A light chain[215 aa] A 100.0
/78.9
10
/10
SPIKE_SARS2 Spike glycoprotein
6zer[9] H heavy chain[220 aa] G 90.9
/74.4
11
/11
SPIKE_SARS2 RBD
6zdh[3] H EY6A heavy chain[219 aa] B 0.0
/78.9
3
/3
SPIKE_SARS2 Spike glycoprotein
6zdh[3] D EY6A heavy chain[219 aa] A 90.9
/78.9
11
/11
SPIKE_SARS2 Spike glycoprotein
6zdg[1] B EY6A heavy chain[219 aa] D 0.0
/74.1
1
/1
SPIKE_SARS2 Spike glycoprotein
7byr[1] D Ab23-Fab-Heavy Chain[102 aa] B 35.7
/78.2
14
/14
SPIKE_SARS2 SARS-CoV-2 Spike glycoprotein
7cah[1] B Heavy chain of H014 Fab[120 aa] C 92.3
/78.1
13
/13
SPIKE_SARS2 Spike glycoprotein
7cah[1] A Light chain of H014 Fab[105 aa] C 71.4
/78.1
7
/7
SPIKE_SARS2 Spike glycoprotein
7c2l[3] H heavy chain of 4A8[229 aa] C 0.0
/77.8
5
/11
Spike glycoprotein
6xey[3] G 2-4 Heavy Chain[122 aa] C 33.3
/77.6
12
/13
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6xe1[5] A CV30 Fab Heavy chain[219 aa] C 42.1
/74.3
19
/19
SPIKE_SARS2 Spike protein S1
6xc4[3] B CC12.3 heavy chain[220 aa] A 44.4
/73.7
18
/18
SPIKE_SARS2 Spike protein S1
6yor[4] F IgG L chain[219 aa] D 85.7
/74.2
7
/7
SPIKE_SARS2 Spike glycoprotein
6xc3[3] B CR3022 light chain[221 aa] E 100.0
/74.5
4
/4
SPIKE_SARS2 Spike protein S1
6yla[3] F Light chain[219 aa] D 80.0
/74.2
10
/10
SPIKE_SARS2 Spike glycoprotein
6z2m[2] C CR3022 antibody[219 aa] A 85.7
/74.5
7
/7
SPIKE_SARS2 Spike glycoprotein
6xc4[4] F CC12.3 light chain[213 aa] D 60.0
/74.1
5
/5
SPIKE_SARS2 Spike protein S1
7c01[2] E CB6 heavy chain[218 aa] D 36.8
/74.2
19
/19
SPIKE_SARS2 SARS-Cov-2 Spike protein S1
6z2m[12] E CR3022 antibody[216 aa] D 93.8
/74.2
16
/16
SPIKE_SARS2 Spike glycoprotein
6zhd[6] E Nanobody H11-H4[128 aa] C 30.8
/79.2
13
/14
SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin
6zbp[6] B H11-H4[128 aa] A 30.8
/74.2
13
/14
SPIKE_SARS2 Spike glycoprotein
6zhd[1] F Nanobody H11-H4[128 aa] A 100.0
/79.4
1
/1
SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin
6zcz[1] B Nanobody[125 aa] A 35.7
/74.1
14
/15
SPIKE_SARS2 Spike glycoprotein
7c8w[2] A Synthetic nanobody MR17[120 aa] B 41.2
/74.2
17
/18
SPIKE_SARS2 Spike glycoprotein
6xdg[1] B REGN10933 antibody Fab fragment light chain[214 aa.. A 0.0
/74.1
1
/1
SPIKE_SARS2 Spike glycoprotein
6xdg[1] D REGN10987 antibody Fab fragment heavy chain[212 aa.. A 33.3
/74.1
9
/9
SPIKE_SARS2 Spike glycoprotein
7bwj[1] B antibody light chain[213 aa] A 0.0
/74.1
2
/3
SPIKE_SARS2 SARS-CoV-2 receptor binding domain
7bwj[1] C antibody heavy chain[229 aa] A 36.4
/74.1
11
/11
SPIKE_SARS2 SARS-CoV-2 receptor binding domain
7c8v[1] A Synthetic nanobody SR4[119 aa] B 45.0
/74.1
20
/20
SPIKE_SARS2 Spike glycoprotein
6xdg[1] C REGN10933 antibody Fab fragment heavy chain[212 aa.. A 36.4
/74.1
11
/11
SPIKE_SARS2 Spike glycoprotein
6m17[2] B ACE2_HUMAN Angiotensin-converting enzyme 2[748 aa] C 56.2
/73.1
16
/16
SPIKE_SARS2 SARS-coV-2 Receptor Binding Domain
5yl9[3] B SPIKE_CVH22 Spike glycoprotein[55 aa] A 50.0
/54.1
30
/36
SPIKE_CVH22 Spike glycoprotein
5yl9[3] B SPIKE_CVH22 Spike glycoprotein[55 aa] A 56.0
/54.1
25
/33
SPIKE_CVH22 Spike glycoprotein
5w9o[24] H G4 VH[119 aa] G 0.0
/46.9
8
/13
W5ZZF5_9BETC Spike glycoprotein
5w9i[17] D G4 VL[111 aa] A 50.0
/46.9
2
/6
W5ZZF5_9BETC Spike glycoprotein
6pz8[3] J W6A090_9BETC S protein[513 aa] A 38.2
/46.9
34
/35
W5ZZF5_9BETC S protein
6pz8[3] A W5ZZF5_9BETC S protein[463 aa] J 44.4
/43.9
9
/35
W6A090_9BETC S protein
6nb3[3] C LCA60 heavy chain[124 aa] G 33.3
/37.4
3
/7
A0A140AYW5_9BETC Spike glycoprotein
6nb3[1] C LCA60 heavy chain[124 aa] A 100.0
/37.4
1
/1
A0A140AYW5_9BETC Spike glycoprotein
6nb4[3] E LCA60 light chain[106 aa] A 22.2
/37.4
9
/10
A0A140AYW5_9BETC Spike glycoprotein
6vsj[3] D CEAM1_MOUSE Carcinoembryonic antigen-related cell adhesion mol.. C 0.0
/33.8
6
/17
SPIKE_CVMA5 Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
1255 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3d0g[2] N NDG
2-acetamido-2-deoxy-alpha-D-glucopyranose[15 atoms..
D 100.0
/100.0
1
/1
SPIKE_CVHSA Spike glycoprotein
6xcm[1] EA FUC
ALPHA-L-FUCOSE[10 atoms]
B 100.0
/79.6
1
/1
SPIKE_SARS2 Spike glycoprotein
6nb6[379] FB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.7
2
/2
SPIKE_CVHSA Spike glycoprotein
6zoy[20] WA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/77.3
2
/2
SPIKE_SARS2 Spike glycoprotein
6vyb[34] TA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/80.9
2
/2
SPIKE_SARS2 Spike glycoprotein
6zge[8] ZA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/76.7
1
/1
SPIKE_SARS2 Spike glycoprotein
6ohw[95] LA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.9
1
/1
Q696P8_CVHOC Spike surface glycoprotein
6zdh[4] LA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/78.9
1
/1
SPIKE_SARS2 Spike glycoprotein
7c2l[38] BA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/78.0
1
/1
Spike glycoprotein
6q05[14] SA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/37.8
1
/1
K0BRG7_9BETC Spike glycoprotein
6zdh[85] MA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/78.9
1
/1
SPIKE_SARS2 Spike glycoprotein
6x6p[6] KA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 66.7
/78.6
3
/3
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6vsb[138] KA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/79.6
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7c2l[58] QC NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 66.7
/77.8
3
/3
Spike glycoprotein
6ixa[7] GB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/38.3
1
/1
SPIKE_CVH22 Spike glycoprotein
5w9h[10] BB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
K 0.0
/27.9
3
/3
W5ZZF5_9BETC MERS S
6wpt[18] AB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 75.0
/80.6
4
/4
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6xm4[36] X NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 66.7
/78.3
3
/3
SPIKE_SARS2 Spike glycoprotein
6x6p[3] FB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/78.6
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6xm3[15] OA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 50.0
/78.5
2
/2
SPIKE_SARS2 Spike glycoprotein
5x58[5] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
1
/1
Spike glycoprotein
6u7k[2] RA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/41.7
1
/6
SPIKE_PEDV7 Spike glycoprotein
6cs2[16] JA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.7
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zoy[7] R NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 66.7
/77.3
3
/3
SPIKE_SARS2 Spike glycoprotein
6cs2[36] KA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.7
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
5x58[20] R NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
3
/3
Spike glycoprotein
5x59[3] DA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/37.0
1
/1
W6A028_9BETC S protein
6m3w[4] P NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
2
/2
SPIKE_CVHSA Spike glycoprotein
6zp0[12] PA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 25.0
/77.7
4
/4
SPIKE_SARS2 Spike glycoprotein
6xm0[32] BA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/78.3
1
/1
SPIKE_SARS2 Spike glycoprotein
6zow[38] VA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 66.7
/81.2
3
/3
SPIKE_SARS2 Spike glycoprotein
6nzk[6] HA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 33.3
/34.9
3
/3
Q696P8_CVHOC Spike surface glycoprotein
6ixa[18] DA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/38.3
2
/2
SPIKE_CVH22 Spike glycoprotein
6xey[34] IA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/77.7
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6xcm[22] KB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 100.0
/79.6
1
/1
SPIKE_SARS2 Spike glycoprotein
6x6p[3] FA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 100.0
/78.6
2
/2
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6zp1[18] MA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/77.7
3
/3
SPIKE_SARS2 Spike glycoprotein
6jx7[3] NB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/35.4
1
/1
Feline Infectious Peritonitis Virus Spike Protein
6x6p[3] E NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 66.7
/78.6
3
/3
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6m16[3] Y NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/36.4
1
/2
A0A2P1G1L3_9NIDO Spike glycoprotein
6z97[34] GA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/79.6
3
/3
SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin
6x6p[77] J NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/78.6
2
/2
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6vv5[18] YA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/40.7
1
/2
S5RJN4_9ALPC Spike glycoprotein
6vyb[19] DA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 66.7
/80.9
3
/3
SPIKE_SARS2 Spike glycoprotein
6vxx[12] X NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/80.4
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6xr8[6] IB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 0.0
/77.3
2
/3
SPIKE_SARS2 Spike glycoprotein
6xlu[28] LA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/78.2
3
/3
SPIKE_SARS2 Spike glycoprotein
6xcm[21] PA NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 100.0
/79.6
3
/3
SPIKE_SARS2 Spike glycoprotein
6zge[9] TA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/76.7
1
/1
SPIKE_SARS2 Spike glycoprotein
6m16[3] FA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 25.0
/36.4
4
/7
A0A2P1G1L3_9NIDO Spike glycoprotein
6xr8[8] TB NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
C 0.0
/77.3
1
/1
SPIKE_SARS2 Spike glycoprotein
6bfu[3] MB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/37.1
1
/1
A0A140ES81_9NIDO Spike protein
6zgf[7] MA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/78.5
2
/2
A0A6B9WHD3_CVHSA Spike glycoprotein
6m16[6] UA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/36.4
1
/1
A0A2P1G1L3_9NIDO Spike glycoprotein
6zp2[18] GA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/77.4
1
/1
SPIKE_SARS2 Spike glycoprotein
6vsb[38] W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/79.7
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6ixa[9] IB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/38.3
1
/1
SPIKE_CVH22 Spike glycoprotein
6zp1[11] QA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/77.7
1
/1
SPIKE_SARS2 Spike glycoprotein
6m3w[3] R NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/100.0
1
/1
SPIKE_CVHSA Spike glycoprotein
6zgf[3] GB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/78.5
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
6crw[6] HA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.7
3
/3
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zoz[18] HA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/77.4
1
/1
SPIKE_SARS2 Spike glycoprotein
5x58[6] AA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
3
/3
Spike glycoprotein
6crv[3] X NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.7
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6xm5[5] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/78.5
1
/1
SPIKE_SARS2 Spike glycoprotein
5szs[2] BC NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 33.3
/34.0
3
/3
SPIKE_CVHNL Spike glycoprotein
6zdh[14] GA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/78.9
1
/1
SPIKE_SARS2 Spike glycoprotein
5x58[3] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
1
/1
Spike glycoprotein
6zgi[2] LA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/76.7
1
/1
SPIKE_SARS2 Spike glycoprotein
6bfu[3] CB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/37.1
2
/2
A0A140ES81_9NIDO Spike protein
6xkl[14] NA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/79.4
1
/1
SPIKE_SARS2 Spike glycoprotein
6m16[3] W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/36.4
2
/2
A0A2P1G1L3_9NIDO Spike glycoprotein
6zox[16] WA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/77.5
2
/2
SPIKE_SARS2 Spike glycoprotein
6xm3[11] TA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/78.5
3
/3
SPIKE_SARS2 Spike glycoprotein
6nb3[16] DB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 25.0
/37.4
4
/4
A0A140AYW5_9BETC Spike glycoprotein
6m15[3] OA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/33.6
1
/1
A8JNZ2_9ALPC Spike glycoprotein
6m3w[3] Y NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/100.0
1
/1
SPIKE_CVHSA Spike glycoprotein
6m15[3] Y NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/33.6
1
/2
A8JNZ2_9ALPC Spike glycoprotein
6ixb[6] NA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/38.5
2
/2
SPIKE_CVH22 Spike glycoprotein
6ixb[4] OA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/38.5
2
/2
SPIKE_CVH22 Spike glycoprotein
6qfy[1] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/32.3
1
/2
A0A1Z2WUW0_9BETC Spike glycoprotein
6jx7[3] JC NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/35.4
1
/2
Feline Infectious Peritonitis Virus Spike Protein
6cv0[3] YA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/39.7
1
/1
F4MIW6_9GAMC Spike glycoprotein
6vv5[3] KA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 66.7
/40.7
3
/3
S5RJN4_9ALPC Spike glycoprotein
6m3w[3] S NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
2
/2
SPIKE_CVHSA Spike glycoprotein
6m3w[3] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
SPIKE_CVHSA Spike glycoprotein
6nb6[4] DB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.7
1
/1
SPIKE_CVHSA Spike glycoprotein
6nb7[6] CB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.7
1
/1
SPIKE_CVHSA Spike glycoprotein
6m15[3] NA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 20.0
/33.6
5
/5
A8JNZ2_9ALPC Spike glycoprotein
6wps[3] AA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 0.0
/80.5
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6vyb[1] CA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/80.5
1
/1
SPIKE_SARS2 Spike glycoprotein
6u7h[3] SA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/38.4
1
/1
spike glycoprotein
6bfu[3] LB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 33.3
/37.1
3
/3
A0A140ES81_9NIDO Spike protein
6m3w[3] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
SPIKE_CVHSA Spike glycoprotein
6vsb[1] RA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/79.6
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6ixa[6] RA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 25.0
/38.3
4
/4
SPIKE_CVH22 Spike glycoprotein
5x58[3] W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
3
/3
Spike glycoprotein
2ajf[5] P NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/100.0
2
/2
SPIKE_CVHSA SARS-coronavirus spike protein
5x58[3] IA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
2
/2
Spike glycoprotein
6x6p[3] Q NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
A 100.0
/78.6
3
/3
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6ixa[3] Z NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/38.3
1
/1
SPIKE_CVH22 Spike glycoprotein
6zgf[3] VA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/78.5
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
5x58[3] HA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
2
/2
Spike glycoprotein
6b7n[3] FA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/36.9
1
/1
A0A075E3D7_9NIDO Spike protein
5x59[3] BA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 50.0
/37.0
2
/2
W6A028_9BETC S protein
6m15[3] VA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/33.6
2
/2
A8JNZ2_9ALPC Spike glycoprotein
6xr8[1] DD NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 0.0
/77.3
1
/1
SPIKE_SARS2 Spike glycoprotein
6u7h[3] NA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/38.4
2
/2
spike glycoprotein
5xgr[2] U NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
E 100.0
/33.6
1
/1
SPIKE_BCHK5 Spike protein S1
5x58[3] NA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
1
/1
Spike glycoprotein
6xra[3] DA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/91.1
1
/1
SPIKE_SARS2 Spike glycoprotein
5x58[3] AA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
4
/4
Spike glycoprotein
6nb6[1] YA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.7
2
/2
SPIKE_CVHSA Spike glycoprotein
6bfu[2] XA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/37.1
2
/2
A0A140ES81_9NIDO Spike protein
5szs[3] AC NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 33.3
/34.0
3
/3
SPIKE_CVHNL Spike glycoprotein
6yla[1] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/74.7
1
/2
SPIKE_SARS2 Spike glycoprotein
6wpt[1] DA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 66.7
/80.7
3
/3
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
5w9h[1] JA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/46.9
1
/1
W5ZZF5_9BETC MERS S
5w9h[1] YA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
K 0.0
/27.9
1
/1
W5ZZF5_9BETC MERS S
6xlu[1] JA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/78.2
1
/1
SPIKE_SARS2 Spike glycoprotein
6yla[1] X PG0
2-(2-METHOXYETHOXY)ETHANOL[8 atoms]
D 80.0
/74.2
5
/5
SPIKE_SARS2 Spike glycoprotein
6q06[12] ZA FOL
FOLIC ACID[32 atoms]
B 100.0
/37.8
2
/13
K0BRG7_9BETC Spike glycoprotein
6nzk[3] YA MJJ
methyl 9-O-acetyl-5-acetamido-3,5-dideoxy-D-glycer..
C 0.0
/34.9
5
/11
Q696P8_CVHOC Spike surface glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
1255 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1zv8[3] Q NA
SODIUM ION[1 atoms]
G 100.0
/100.0
2
/2
VGL2_CVHSA E2 glycoprotein
1zv8[2] M NA
SODIUM ION[1 atoms]
B 100.0
/100.0
1
/1
VGL2_CVHSA E2 glycoprotein
1zv8[1] N NA
SODIUM ION[1 atoms]
B 100.0
/100.0
1
/1
VGL2_CVHSA E2 glycoprotein
1zv8[1] U NA
SODIUM ION[1 atoms]
J 100.0
/100.0
1
/1
VGL2_CVHSA E2 glycoprotein
6lxt[1] J ZN
ZINC ION[1 atoms]
A 100.0
/92.2
1
/1
SPIKE_SARS2 SPIKE_SARS2 Spike protein S2, Spike protein S2
6lxt[2] M ZN
ZINC ION[1 atoms]
F 100.0
/92.0
2
/2
SPIKE_SARS2 SPIKE_SARS2 Spike protein S2, Spike protein S2
1zv8[2] S ZN
ZINC ION[1 atoms]
H 100.0
/100.0
1
/1
VGL2_CVHSA E2 glycoprotein
6lxt[1] N ZN
ZINC ION[1 atoms]
F 100.0
/92.0
1
/1
SPIKE_SARS2 SPIKE_SARS2 Spike protein S2, Spike protein S2
6lxt[1] L ZN
ZINC ION[1 atoms]
B 100.0
/92.2
1
/1
SPIKE_SARS2 SPIKE_SARS2 Spike protein S2, Spike protein S2
6lxt[1] K ZN
ZINC ION[1 atoms]
B 0.0
/92.2
1
/1
SPIKE_SARS2 SPIKE_SARS2 Spike protein S2, Spike protein S2
1zv8[1] P ZN
ZINC ION[1 atoms]
G 100.0
/100.0
1
/1
VGL2_CVHSA E2 glycoprotein
1wyy[18] F CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
1
/1
SPIKE_CVHSA E2 Glycoprotein
2ghw[1] F CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
SPIKE_CVHSA Spike glycoprotein
2ghw[3] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
SPIKE_CVHSA Spike glycoprotein
6zcz[1] F CL
CHLORIDE ION[1 atoms]
A 50.0
/74.1
2
/2
SPIKE_SARS2 Spike glycoprotein
1zv7[4] C CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
1
/1
SPIKE_CVHSA spike glycoprotein
5zuv[1] E CL
CHLORIDE ION[1 atoms]
B 100.0
/49.1
1
/1
SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK..
2ghw[1] H CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
SPIKE_CVHSA Spike glycoprotein
5zuv[1] D CL
CHLORIDE ION[1 atoms]
A 0.0
/49.1
1
/1
SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK..
5kwb[1] L MG
MAGNESIUM ION[1 atoms]
A 66.7
/27.7
3
/5
SPIKE_CVHN1 Spike glycoprotein
5kwb[1] K MG
MAGNESIUM ION[1 atoms]
A 50.0
/27.7
2
/2
SPIKE_CVHN1 Spike glycoprotein
5kwb[1] H MG
MAGNESIUM ION[1 atoms]
A 0.0
/27.7
2
/4
SPIKE_CVHN1 Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
1255 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6nb7[2] T alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/99.7
4
/4
SPIKE_CVHSA Spike glycoprotein
6cs0[8] E alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/99.7
3
/3
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[2] K alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/99.7
5
/5
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
5szs[3] PA alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 75.0
/34.0
4
/4
SPIKE_CVHNL Spike glycoprotein
6crx[8] X alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/99.7
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[5] AA alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. C 100.0
/99.7
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6q04[13] R alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 100.0
/37.8
1
/7
K0BRG7_9BETC Spike glycoprotein
6ohw[6] J alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 25.0
/34.9
4
/5
Q696P8_CVHOC Spike surface glycoprotein
6nzk[3] P alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. C 75.0
/34.9
4
/4
Q696P8_CVHOC Spike surface glycoprotein
6crx[8] G alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/99.7
5
/5
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zow[6] S alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 75.0
/81.0
4
/4
SPIKE_SARS2 Spike glycoprotein
6cs2[1] P alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 100.0
/99.7
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zp5[3] U alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. C 100.0
/81.2
1
/1
SPIKE_SARS2 Spike glycoprotein
6zp7[3] F alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/79.5
3
/3
SPIKE_SARS2 Spike glycoprotein
6nb3[1] Q alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/37.4
1
/1
A0A140AYW5_9BETC Spike glycoprotein
6cs2[1] L alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/99.7
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6nzk[3] F alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/34.9
1
/2
Q696P8_CVHOC Spike surface glycoprotein
6crw[1] R alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. C 100.0
/99.7
5
/5
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6q07[3] EA alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 0.0
/37.8
2
/2
K0BRG7_9BETC Spike glycoprotein
6nb4[1] FA alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. C 100.0
/44.6
1
/1
A0A140AYW5_9BETC Spike glycoprotein
6xra[3] P alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. C 100.0
/91.1
3
/3
SPIKE_SARS2 Spike glycoprotein
6xra[3] P alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. B 0.0
/91.1
1
/1
SPIKE_SARS2 Spike glycoprotein
6xra[3] J alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. B 66.7
/91.1
3
/3
SPIKE_SARS2 Spike glycoprotein
6xra[3] L alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/91.1
1
/1
SPIKE_SARS2 Spike glycoprotein
6zp5[3] Q beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/81.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6wps[4] S alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. D 100.0
/80.5
5
/5
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7can[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 100.0
/74.2
3
/3
SPIKE_SARS2 Spike glycoprotein
6zgf[3] R 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 50.0
/78.5
2
/2
A0A6B9WHD3_CVHSA Spike glycoprotein
6zgf[3] GA alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. C 100.0
/78.5
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
6zgf[3] W alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. A 33.3
/78.5
3
/3
A0A6B9WHD3_CVHSA Spike glycoprotein
6xey[2] M beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 0.0
/77.7
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7c8w[1] C alpha-L-fucopyranose-(1-3)-[2-acetamido-2-deoxy-be.. B 100.0
/74.2
3
/3
SPIKE_SARS2 Spike glycoprotein
6b7n[3] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/36.9
1
/1
A0A075E3D7_9NIDO Spike protein
6m17[2] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/73.1
1
/1
SPIKE_SARS2 SARS-coV-2 Receptor Binding Domain
6b7n[3] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 22.2
/36.9
9
/9
A0A075E3D7_9NIDO Spike protein
6bfu[3] O alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 30.0
/37.1
10
/10
A0A140ES81_9NIDO Spike protein
6u7k[3] N alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. B 0.0
/41.7
1
/1
SPIKE_PEDV7 Spike glycoprotein
6bfu[3] BA alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 0.0
/37.1
1
/1
A0A140ES81_9NIDO Spike protein
6nb3[1] P alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. G 0.0
/37.4
3
/5
A0A140AYW5_9BETC Spike glycoprotein
6nb3[2] L alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. G 0.0
/37.4
1
/1
A0A140AYW5_9BETC Spike glycoprotein
6nb3[1] P alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 33.3
/37.4
3
/3
A0A140AYW5_9BETC Spike glycoprotein
6vv5[3] N alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. C 0.0
/40.7
4
/4
S5RJN4_9ALPC Spike glycoprotein
6jx7[3] T alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 0.0
/35.4
5
/5
Feline Infectious Peritonitis Virus Spike Protein
6ixa[3] D alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. C 0.0
/38.3
1
/1
SPIKE_CVH22 Spike glycoprotein
6q04[12] P alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 25.0
/37.8
4
/6
K0BRG7_9BETC Spike glycoprotein
6q04[12] Z alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. C 25.0
/37.8
4
/4
K0BRG7_9BETC Spike glycoprotein
6wpt[1] K beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/80.7
5
/5
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6jx7[3] BB beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 0.0
/35.4
1
/1
Feline Infectious Peritonitis Virus Spike Protein
6jx7[3] O alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. C 33.3
/35.4
3
/3
Feline Infectious Peritonitis Virus Spike Protein
6cs0[3] S alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. C 100.0
/99.7
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[1] U alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. B 100.0
/99.7
3
/3
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6jx7[3] YA alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. C 0.0
/35.4
2
/2
Feline Infectious Peritonitis Virus Spike Protein
6nb6[2] DA alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. B 100.0
/99.7
5
/5
SPIKE_CVHSA Spike glycoprotein
6nb7[1] GA alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. B 100.0
/99.7
2
/2
SPIKE_CVHSA Spike glycoprotein
6jx7[3] ZA alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. C 0.0
/35.4
1
/1
Feline Infectious Peritonitis Virus Spike Protein
6cs1[4] Q beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/99.7
7
/7
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6nb6[6] LA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.7
3
/3
SPIKE_CVHSA Spike glycoprotein
6nb7[5] L beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.7
1
/1
SPIKE_CVHSA Spike glycoprotein
6zow[6] CA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/81.2
4
/4
SPIKE_SARS2 Spike glycoprotein
6cs1[8] V beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.7
5
/5
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6bfu[3] KA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 33.3
/37.1
6
/6
A0A140ES81_9NIDO Spike protein
6bfu[3] JA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/37.1
1
/1
A0A140ES81_9NIDO Spike protein
6ohw[7] N beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 50.0
/34.9
2
/2
Q696P8_CVHOC Spike surface glycoprotein
6nb6[4] I beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.7
2
/2
SPIKE_CVHSA Spike glycoprotein
6nb6[2] J beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/99.7
1
/1
SPIKE_CVHSA Spike glycoprotein
6ixa[3] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/38.3
4
/7
SPIKE_CVH22 Spike glycoprotein
6cs2[6] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.7
3
/3
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6crx[8] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.7
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6nzk[6] M beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 25.0
/34.9
4
/4
Q696P8_CVHOC Spike surface glycoprotein
6zow[3] BA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/81.2
2
/2
SPIKE_SARS2 Spike glycoprotein
6nb3[5] K beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. G 100.0
/37.4
1
/1
A0A140AYW5_9BETC Spike glycoprotein
6zgf[3] I beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 66.7
/78.5
3
/3
A0A6B9WHD3_CVHSA Spike glycoprotein
6nb7[5] LA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.7
4
/4
SPIKE_CVHSA Spike glycoprotein
6ohw[3] Z beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 66.7
/34.9
3
/3
Q696P8_CVHOC Spike surface glycoprotein
6nzk[6] Y beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 0.0
/34.9
6
/7
Q696P8_CVHOC Spike surface glycoprotein
6nb7[5] AA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.7
2
/2
SPIKE_CVHSA Spike glycoprotein
6zp5[3] N beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/81.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6cs2[1] V beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/99.7
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6m16[6] O beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 33.3
/36.4
3
/3
A0A2P1G1L3_9NIDO Spike glycoprotein
6nzk[6] AA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 20.0
/34.9
5
/7
Q696P8_CVHOC Spike surface glycoprotein
6q04[15] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/37.8
2
/2
K0BRG7_9BETC Spike glycoprotein
6cs0[4] R beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.7
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6nb6[8] N beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.7
2
/2
SPIKE_CVHSA Spike glycoprotein
6nzk[3] BA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/34.9
1
/2
Q696P8_CVHOC Spike surface glycoprotein
6crz[9] M beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/99.7
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6nb6[1] IA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.7
2
/2
SPIKE_CVHSA Spike glycoprotein
6bfu[3] N beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/37.1
1
/4
A0A140ES81_9NIDO Spike protein
6nb6[6] Y beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/99.7
3
/3
SPIKE_CVHSA Spike glycoprotein
6vw1[1] L beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/85.9
5
/5
SPIKE_CVHSA SPIKE_SARS2 SPIKE_CVHSA SARS-CoV-2 chimeric RBD
6nb6[6] FA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.7
2
/2
SPIKE_CVHSA Spike glycoprotein
6nb7[10] EA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/99.7
3
/3
SPIKE_CVHSA Spike glycoprotein
6cs1[11] L beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/99.7
3
/3
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6ohw[3] Z beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/34.9
1
/2
Q696P8_CVHOC Spike surface glycoprotein
6nb3[2] R beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/37.4
1
/1
A0A140AYW5_9BETC Spike glycoprotein
6bfu[3] M beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/37.1
2
/2
A0A140ES81_9NIDO Spike protein
5szs[3] NB beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 33.3
/34.0
6
/6
SPIKE_CVHNL Spike glycoprotein
6nb7[2] JA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.7
2
/2
SPIKE_CVHSA Spike glycoprotein
6nb7[2] TA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.7
2
/2
SPIKE_CVHSA Spike glycoprotein
6nb6[2] NA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.7
2
/2
SPIKE_CVHSA Spike glycoprotein
6bfu[3] L beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/37.1
4
/4
A0A140ES81_9NIDO Spike protein
6cs0[4] R beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.7
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
5szs[3] JA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 33.3
/34.0
3
/3
SPIKE_CVHNL Spike glycoprotein
6cs2[1] W beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.7
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6vw1[1] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/85.9
2
/2
SPIKE_CVHSA SPIKE_SARS2 SPIKE_CVHSA SARS-CoV-2 chimeric RBD
6nb4[5] QA alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 50.0
/37.4
2
/2
A0A140AYW5_9BETC Spike glycoprotein
5szs[3] QA alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 33.3
/34.0
6
/6
SPIKE_CVHNL Spike glycoprotein
6nb3[5] W alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 100.0
/37.4
1
/8
A0A140AYW5_9BETC Spike glycoprotein
5szs[3] DB alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 40.0
/34.0
5
/6
SPIKE_CVHNL Spike glycoprotein
6jx7[3] S alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 25.0
/35.4
4
/5
Feline Infectious Peritonitis Virus Spike Protein
6q05[10] L alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 0.0
/37.8
2
/2
K0BRG7_9BETC Spike glycoprotein
6nb6[6] PA alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 100.0
/99.7
5
/5
SPIKE_CVHSA Spike glycoprotein
6cs1[1] G alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 100.0
/99.7
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6nb6[2] P alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 100.0
/99.7
4
/4
SPIKE_CVHSA Spike glycoprotein
6nb7[3] U alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 100.0
/99.7
2
/2
SPIKE_CVHSA Spike glycoprotein
6bfu[3] IA alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 20.0
/37.1
5
/6
A0A140ES81_9NIDO Spike protein
6nb6[2] RA alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 100.0
/99.7
4
/4
SPIKE_CVHSA Spike glycoprotein
6nb6[2] M alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 100.0
/99.7
2
/2
SPIKE_CVHSA Spike glycoprotein
6cs1[1] H alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 100.0
/99.7
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs1[1] S alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 100.0
/99.7
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs1[1] S alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 100.0
/99.7
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
5szs[3] AB alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. C 33.3
/34.0
3
/10
SPIKE_CVHNL Spike glycoprotein
5szs[3] K alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. B 0.0
/34.0
3
/3
SPIKE_CVHNL Spike glycoprotein
6xm4[3] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 50.0
/78.5
2
/2
SPIKE_SARS2 Spike glycoprotein
6zp1[18] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/77.7
3
/3
SPIKE_SARS2 Spike glycoprotein
6xra[120] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/91.1
2
/2
SPIKE_SARS2 Spike glycoprotein
6zgf[9] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/78.5
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
6zox[15] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/77.5
2
/2
SPIKE_SARS2 Spike glycoprotein
6q04[18] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/37.8
1
/2
K0BRG7_9BETC Spike glycoprotein
6z97[24] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/79.6
3
/3
SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin
6xm3[11] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 66.7
/78.3
3
/3
SPIKE_SARS2 Spike glycoprotein
5szs[3] Q 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/34.0
2
/3
SPIKE_CVHNL Spike glycoprotein
6zgi[6] V 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 0.0
/76.7
1
/3
SPIKE_SARS2 Spike glycoprotein
6zp5[3] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/81.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6zwv[39] Q 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 66.7
/80.1
3
/3
SPIKE_SARS2 Spike glycoprotein
6crx[5] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.7
5
/5
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
5szs[3] MA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 50.0
/34.0
2
/2
SPIKE_CVHNL Spike glycoprotein
6u7k[9] M 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 50.0
/41.7
2
/2
SPIKE_PEDV7 Spike glycoprotein
6crv[8] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.7
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zgi[9] O 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/76.7
1
/1
SPIKE_SARS2 Spike glycoprotein
6z97[42] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 66.7
/79.2
3
/3
SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin
6zow[22] DA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/81.2
3
/3
SPIKE_SARS2 Spike glycoprotein
6m15[3] W 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/33.6
1
/2
A8JNZ2_9ALPC Spike glycoprotein
6zp2[12] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 66.7
/77.4
3
/3
SPIKE_SARS2 Spike glycoprotein
6zge[9] BA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 66.7
/76.7
3
/3
SPIKE_SARS2 Spike glycoprotein
6crw[5] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.7
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zhd[7] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/79.4
2
/2
SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin
6wps[14] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/80.5
3
/3
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6zow[9] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/81.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6zge[12] CA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/76.7
2
/2
SPIKE_SARS2 Spike glycoprotein
6xm0[15] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/78.3
1
/1
SPIKE_SARS2 Spike glycoprotein
6z97[9] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/79.2
2
/2
SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin
6xm5[37] Q 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/78.5
3
/3
SPIKE_SARS2 Spike glycoprotein
6xra[3] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/91.1
1
/1
SPIKE_SARS2 Spike glycoprotein
6pz8[3] DA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. I 0.0
/46.9
3
/3
W5ZZF5_9BETC S protein
6vyb[25] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 75.0
/80.5
4
/4
SPIKE_SARS2 Spike glycoprotein
6crx[9] U 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.7
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zow[8] AA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/81.0
1
/1
SPIKE_SARS2 Spike glycoprotein
5w9i[6] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/46.9
2
/2
W5ZZF5_9BETC Spike glycoprotein
6zgf[9] Q 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 40.0
/78.5
5
/5
A0A6B9WHD3_CVHSA Spike glycoprotein
6zge[6] EA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/76.7
3
/3
SPIKE_SARS2 Spike glycoprotein
5w9h[5] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/46.9
2
/4
W5ZZF5_9BETC MERS S
6b7n[3] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 0.0
/36.9
1
/3
A0A075E3D7_9NIDO Spike protein
6nb4[6] NA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 33.3
/44.6
3
/3
A0A140AYW5_9BETC Spike glycoprotein
6cs2[4] Z 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.7
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zp7[12] S 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 66.7
/81.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6zge[3] W 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/76.7
1
/1
SPIKE_SARS2 Spike glycoprotein
6zge[6] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/76.7
2
/2
SPIKE_SARS2 Spike glycoprotein
6cv0[3] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 42.9
/39.7
7
/7
F4MIW6_9GAMC Spike glycoprotein
6nzk[6] CA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 0.0
/34.9
1
/1
Q696P8_CVHOC Spike surface glycoprotein
6ohw[6] V 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/34.9
3
/3
Q696P8_CVHOC Spike surface glycoprotein
5w9i[6] T 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. E 50.0
/46.9
4
/4
W5ZZF5_9BETC Spike glycoprotein
6z97[7] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 50.0
/79.2
2
/2
SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin
6nb6[1] U 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.7
1
/1
SPIKE_CVHSA Spike glycoprotein
6vxx[11] M 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/80.4
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6crw[6] M 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.7
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6pz8[3] U 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. E 50.0
/46.9
2
/2
W5ZZF5_9BETC S protein
6xlu[7] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 40.0
/78.0
5
/5
SPIKE_SARS2 Spike glycoprotein
6jx7[3] AB 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 75.0
/35.4
4
/4
Feline Infectious Peritonitis Virus Spike Protein
6xm4[4] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/78.5
3
/3
SPIKE_SARS2 Spike glycoprotein
6zp0[12] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 75.0
/77.7
4
/4
SPIKE_SARS2 Spike glycoprotein
6crz[3] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.7
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zgf[6] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/78.5
3
/3
A0A6B9WHD3_CVHSA Spike glycoprotein
6qfy[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/32.1
4
/6
A0A1Z2WUW0_9BETC Spike glycoprotein
6m16[3] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/36.4
2
/2
A0A2P1G1L3_9NIDO Spike glycoprotein
6zgf[3] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 33.3
/78.5
3
/3
A0A6B9WHD3_CVHSA Spike glycoprotein
6zgi[6] AA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 75.0
/76.7
4
/4
SPIKE_SARS2 Spike glycoprotein
6jx7[3] EA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 50.0
/35.4
2
/2
Feline Infectious Peritonitis Virus Spike Protein
6vxx[4] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/80.4
2
/2
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6xm5[4] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/78.5
2
/2
SPIKE_SARS2 Spike glycoprotein
6nb4[1] V 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/37.4
1
/1
A0A140AYW5_9BETC Spike glycoprotein
5szs[3] RA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 40.0
/34.0
5
/5
SPIKE_CVHNL Spike glycoprotein
6m15[3] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/33.6
2
/2
A8JNZ2_9ALPC Spike glycoprotein
6b7n[3] R 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 25.0
/36.9
4
/4
A0A075E3D7_9NIDO Spike protein
5gyq[1] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/30.3
3
/6
SPIKE_BCHK9 Spike glycoprotein
6vv5[3] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/40.7
3
/3
S5RJN4_9ALPC Spike glycoprotein
6nb4[3] PA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 33.3
/44.6
3
/3
A0A140AYW5_9BETC Spike glycoprotein
6zgf[9] O 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 75.0
/78.5
4
/4
A0A6B9WHD3_CVHSA Spike glycoprotein
6pz8[3] W 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. E 40.0
/46.9
5
/5
W5ZZF5_9BETC S protein
6qfy[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/32.1
4
/5
A0A1Z2WUW0_9BETC Spike glycoprotein
6nb7[1] KA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.7
1
/1
SPIKE_CVHSA Spike glycoprotein
6vv5[3] K 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 40.0
/40.7
5
/5
S5RJN4_9ALPC Spike glycoprotein
6bfu[3] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/37.1
1
/1
A0A140ES81_9NIDO Spike protein
6m15[3] K 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 0.0
/33.6
1
/1
A8JNZ2_9ALPC Spike glycoprotein
6nb4[2] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/37.4
3
/3
A0A140AYW5_9BETC Spike glycoprotein
6cv0[3] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/39.7
2
/6
F4MIW6_9GAMC Spike glycoprotein
6xra[3] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/91.1
2
/2
SPIKE_SARS2 Spike glycoprotein
6nb4[1] M 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/37.4
1
/1
A0A140AYW5_9BETC Spike glycoprotein
6crx[2] BA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.7
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6crx[1] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.7
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1255 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2beq[12] A SPIKE_CVHSA Spike glycoprotein[37 aa] B 100.0
/100.0
5
/5
SPIKE_CVHSA Spike glycoprotein
5x5b[22] A Spike glycoprotein[1033 aa] B 100.0
/99.8
74
/74
Spike glycoprotein
6acc[18] B SPIKE_CVHSA Spike glycoprotein[1065 aa] C 100.0
/100.0
96
/96
SPIKE_CVHSA Spike glycoprotein
5x58[22] C Spike glycoprotein[1052 aa] B 100.0
/99.8
110
/110
Spike glycoprotein
6nb7[6] C SPIKE_CVHSA Spike glycoprotein[1048 aa] A 100.0
/99.7
47
/47
SPIKE_CVHSA Spike glycoprotein
6acc[18] C SPIKE_CVHSA Spike glycoprotein[1065 aa] B 100.0
/100.0
94
/94
SPIKE_CVHSA Spike glycoprotein
6nb7[6] C SPIKE_CVHSA Spike glycoprotein[1048 aa] B 100.0
/99.7
45
/45
SPIKE_CVHSA Spike glycoprotein
2ghv[2] A SPIKE_CVHSA Spike glycoprotein[183 aa] B 100.0
/100.0
18
/18
SPIKE_CVHSA Spike glycoprotein
2bez[6] A SPIKE_CVHSA Spike glycoprotein[77 aa] A 100.0
/100.0
16
/16
SPIKE_CVHSA Spike glycoprotein
5zvm[6] A SPIKE_CVHSA Spike glycoprotein[69 aa] B 100.0
/100.0
21
/21
SPIKE_CVHSA Spike glycoprotein
5wrg[3] B SPIKE_CVHSA Spike glycoprotein[736 aa] A 100.0
/100.0
47
/47
SPIKE_CVHSA Spike glycoprotein
5wrg[3] A SPIKE_CVHSA Spike glycoprotein[736 aa] B 100.0
/100.0
50
/50
SPIKE_CVHSA Spike glycoprotein
6m3w[6] A SPIKE_CVHSA Spike glycoprotein[344 aa] B 100.0
/100.0
114
/114
SPIKE_CVHSA Spike glycoprotein
1wyy[12] B SPIKE_CVHSA E2 Glycoprotein[124 aa] B 100.0
/100.0
40
/40
SPIKE_CVHSA E2 Glycoprotein
1zva[2] A VGL2_CVHSA VGL2_CVHSA E2 glycoprotein[75 aa] A 100.0
/100.0
30
/31
VGL2_CVHSA VGL2_CVHSA E2 glycoprotein
1zvb[6] A SPIKE_CVHSA E2 glycoprotein[34 aa] B 100.0
/100.0
11
/11
SPIKE_CVHSA E2 glycoprotein
2beq[52] F SPIKE_CVHSA Spike glycoprotein[48 aa] E 100.0
/100.0
7
/7
SPIKE_CVHSA Spike glycoprotein
2beq[2] E SPIKE_CVHSA Spike glycoprotein[47 aa] D 100.0
/100.0
1
/1
SPIKE_CVHSA Spike glycoprotein
1zv8[12] K VGL2_CVHSA E2 glycoprotein[50 aa] I 100.0
/100.0
18
/18
VGL2_CVHSA E2 glycoprotein
6cs2[1] C SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[893 aa] A 100.0
/99.7
62
/62
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[1] C SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[893 aa] B 98.6
/99.7
72
/72
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[1] A SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[891 aa] B 100.0
/99.7
64
/64
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[1] A SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[891 aa] C 100.0
/99.7
69
/69
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6crv[3] A SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[881 aa] B 100.0
/99.7
70
/70
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6crv[3] C SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[881 aa] B 98.7
/99.7
79
/79
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
1wnc[8] F VGL2_CVHSA E2 glycoprotein[75 aa] B 100.0
/98.8
8
/8
VGL2_CVHSA E2 glycoprotein
1wnc[6] C VGL2_CVHSA E2 glycoprotein[78 aa] B 100.0
/98.8
17
/17
VGL2_CVHSA E2 glycoprotein
6lxt[6] E SPIKE_SARS2 SPIKE_SARS2 Spike protein S2, Spike protein S2[114 aa] D 100.0
/91.8
42
/42
SPIKE_SARS2 SPIKE_SARS2 Spike protein S2, Spike protein S2
6lxt[6] C SPIKE_SARS2 SPIKE_SARS2 Spike protein S2, Spike protein S2[117 aa] A 85.3
/92.2
34
/34
SPIKE_SARS2 SPIKE_SARS2 Spike protein S2, Spike protein S2
6xra[6] A SPIKE_SARS2 Spike glycoprotein[348 aa] B 95.0
/91.1
120
/120
SPIKE_SARS2 Spike glycoprotein
6m1v[3] A spike protein[91 aa] A 76.9
/89.3
26
/27
spike protein
6m1v[3] A spike protein[91 aa] A 100.0
/89.3
29
/30
spike protein
6zow[1] A SPIKE_SARS2 Spike glycoprotein[801 aa] B 88.8
/81.0
80
/80
SPIKE_SARS2 Spike glycoprotein
6zow[1] A SPIKE_SARS2 Spike glycoprotein[801 aa] D 100.0
/73.8
11
/11
SPIKE_SARS2 Spike glycoprotein
6zow[1] A SPIKE_SARS2 Spike glycoprotein[801 aa] C 90.4
/81.2
73
/73
SPIKE_SARS2 Spike glycoprotein
6zow[1] D SPIKE_SARS2 Spike glycoprotein[188 aa] C 100.0
/81.2
4
/4
SPIKE_SARS2 Spike glycoprotein
6zow[1] D SPIKE_SARS2 Spike glycoprotein[188 aa] A 100.0
/81.0
4
/4
SPIKE_SARS2 Spike glycoprotein
6xs6[1] C SPIKE_SARS2 Spike glycoprotein[787 aa] A 87.9
/79.8
58
/58
SPIKE_SARS2 Spike glycoprotein
6xs6[1] C SPIKE_SARS2 Spike glycoprotein[787 aa] B 88.7
/79.8
53
/53
SPIKE_SARS2 Spike glycoprotein
6xs6[2] B SPIKE_SARS2 Spike glycoprotein[785 aa] A 87.9
/79.8
58
/58
SPIKE_SARS2 Spike glycoprotein
6xs6[2] A SPIKE_SARS2 Spike glycoprotein[785 aa] B 90.9
/79.8
55
/55
SPIKE_SARS2 Spike glycoprotein
6zgi[14] B SPIKE_SARS2 Spike glycoprotein[1098 aa] C 87.2
/76.7
94
/94
SPIKE_SARS2 Spike glycoprotein
6zp1[48] A SPIKE_SARS2 Spike glycoprotein[1017 aa] C 86.1
/77.7
72
/72
SPIKE_SARS2 Spike glycoprotein
6xm0[48] C SPIKE_SARS2 Spike glycoprotein[1032 aa] B 85.7
/78.6
70
/70
SPIKE_SARS2 Spike glycoprotein
6zhd[47] C SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin[990 aa] B 86.1
/79.1
79
/79
SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin
6wpt[12] A SPIKE_SARS2 SARS-CoV-2 spike glycoprotein[945 aa] B 90.0
/80.7
70
/70
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7byr[47] A SPIKE_SARS2 SARS-CoV-2 Spike glycoprotein[959 aa] C 89.3
/80.0
75
/75
SPIKE_SARS2 SARS-CoV-2 Spike glycoprotein
6zgh[14] B PTPRS_CHICK SPIKE_SARS2 WAC_BPT4 Receptor-type tyrosine-protein phosphatase S,Spike.. A 89.2
/77.0
74
/74
PTPRS_CHICK SPIKE_SARS2 WAC_BPT4 Receptor-type tyrosine-protein phosphatase S,Spike..
6zow[1] C SPIKE_SARS2 Spike glycoprotein[930 aa] D 75.0
/73.8
4
/4
SPIKE_SARS2 Spike glycoprotein
6wpt[12] B SPIKE_SARS2 SARS-CoV-2 spike glycoprotein[937 aa] A 89.9
/80.7
79
/79
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6zgh[1] A PTPRS_CHICK SPIKE_SARS2 WAC_BPT4 Receptor-type tyrosine-protein phosphatase S,Spike.. C 91.5
/76.5
82
/82
PTPRS_CHICK SPIKE_SARS2 WAC_BPT4 Receptor-type tyrosine-protein phosphatase S,Spike..
6zgh[1] A PTPRS_CHICK SPIKE_SARS2 WAC_BPT4 Receptor-type tyrosine-protein phosphatase S,Spike.. B 90.3
/76.5
72
/72
PTPRS_CHICK SPIKE_SARS2 WAC_BPT4 Receptor-type tyrosine-protein phosphatase S,Spike..
5zvk[6] B W6A0A7_9BETC Human Coronavirus MERS HR1 motif[70 aa] C 64.7
/55.7
17
/17
W6A0A7_9BETC Human Coronavirus MERS HR1 motif
1wdf[3] B VGL2_CVMA5 E2 glycoprotein[93 aa] A 100.0
/55.4
1
/5
VGL2_CVMA5 E2 glycoprotein
1wdf[3] B VGL2_CVMA5 E2 glycoprotein[93 aa] A 33.3
/55.4
3
/3
VGL2_CVMA5 E2 glycoprotein
1wdf[3] A VGL2_CVMA5 E2 glycoprotein[91 aa] A 57.1
/55.4
28
/28
VGL2_CVMA5 E2 glycoprotein
1wdf[3] A VGL2_CVMA5 E2 glycoprotein[91 aa] A 81.8
/55.4
11
/32
VGL2_CVMA5 E2 glycoprotein
1wdf[3] A VGL2_CVMA5 E2 glycoprotein[91 aa] B 0.0
/57.4
1
/5
VGL2_CVMA5 E2 glycoprotein
1wdg[3] A VGL2_CVMA5 E2 glycoprotein[81 aa] A 50.0
/55.0
22
/25
VGL2_CVMA5 E2 glycoprotein
1wdg[3] A VGL2_CVMA5 E2 glycoprotein[81 aa] A 87.5
/55.0
8
/26
VGL2_CVMA5 E2 glycoprotein
1wdg[3] B VGL2_CVMA5 E2 glycoprotein[74 aa] A 0.0
/55.0
1
/4
VGL2_CVMA5 E2 glycoprotein
1wdg[6] B VGL2_CVMA5 E2 glycoprotein[74 aa] B 71.4
/56.2
14
/25
VGL2_CVMA5 E2 glycoprotein
5yl9[6] A SPIKE_CVH22 Spike glycoprotein[88 aa] A 61.5
/54.1
26
/31
SPIKE_CVH22 Spike glycoprotein
4mod[6] A K0BRG7_9BETC K0BRG7_9BETC HR1 of S protein, LINKER, HR2 of S protein[76 aa] A 50.0
/53.2
26
/26
K0BRG7_9BETC K0BRG7_9BETC HR1 of S protein, LINKER, HR2 of S protein
4mod[6] A K0BRG7_9BETC K0BRG7_9BETC HR1 of S protein, LINKER, HR2 of S protein[76 aa] A 50.0
/53.2
12
/30
K0BRG7_9BETC K0BRG7_9BETC HR1 of S protein, LINKER, HR2 of S protein
4njl[6] A R9UQ53_9BETC S protein[129 aa] A 57.5
/50.8
40
/40
R9UQ53_9BETC S protein
5zuv[2] A SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK.. B 66.7
/49.1
33
/41
SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK..
5zuv[2] A SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK.. C 58.8
/52.4
34
/38
SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK..
5zuv[1] C SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK.. A 68.8
/49.1
32
/40
SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK..
5zuv[1] C SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK.. B 52.6
/49.1
38
/43
SPIKE_CVH22 Spike glycoprotein,Spike glycoprotein,inhibitor EK..
5w9i[6] B W5ZZF5_9BETC Spike glycoprotein[513 aa] J 25.0
/43.9
4
/12
W5ZZF5_9BETC Spike glycoprotein
5w9i[6] B W5ZZF5_9BETC Spike glycoprotein[513 aa] I 36.7
/46.9
30
/31
W5ZZF5_9BETC Spike glycoprotein
5w9m[27] E W5ZZF5_9BETC Spike glycoprotein[463 aa] A 45.8
/46.9
24
/24
W5ZZF5_9BETC Spike glycoprotein
5w9h[21] G W5ZZF5_9BETC MERS S[463 aa] L 21.1
/27.9
19
/22
W5ZZF5_9BETC MERS S
5w9h[27] A W5ZZF5_9BETC MERS S[463 aa] G 16.7
/46.9
12
/23
W5ZZF5_9BETC MERS S
5w9h[27] G W5ZZF5_9BETC MERS S[463 aa] K 30.3
/27.9
33
/37
W5ZZF5_9BETC MERS S
6pz8[3] I W5ZZF5_9BETC S protein[463 aa] A 43.3
/46.9
30
/30
W5ZZF5_9BETC S protein
6pz8[3] A W5ZZF5_9BETC S protein[463 aa] I 18.8
/46.9
16
/32
W5ZZF5_9BETC S protein
6pz8[3] B W6A090_9BETC S protein[513 aa] F 25.0
/43.9
4
/14
W6A090_9BETC S protein
6b3o[6] A SPIKE_CVMA5 Spike glycoprotein[344 aa] C 41.0
/41.9
117
/121
SPIKE_CVMA5 Spike glycoprotein
6u7k[3] B SPIKE_PEDV7 Spike glycoprotein[1064 aa] C 41.7
/41.7
12
/93
SPIKE_PEDV7 Spike glycoprotein
6u7k[3] B SPIKE_PEDV7 Spike glycoprotein[1064 aa] A 31.6
/41.7
79
/106
SPIKE_PEDV7 Spike glycoprotein
6vv5[3] A S5RJN4_9ALPC Spike glycoprotein[1098 aa] C 46.7
/40.7
15
/102
S5RJN4_9ALPC Spike glycoprotein
6vv5[3] B S5RJN4_9ALPC Spike glycoprotein[1098 aa] C 26.8
/40.7
71
/97
S5RJN4_9ALPC Spike glycoprotein
6cv0[3] C F4MIW6_9GAMC Spike glycoprotein[993 aa] B 17.4
/39.7
23
/106
F4MIW6_9GAMC Spike glycoprotein
6cv0[3] B F4MIW6_9GAMC Spike glycoprotein[993 aa] C 27.5
/39.7
69
/108
F4MIW6_9GAMC Spike glycoprotein
6u7h[3] A spike glycoprotein[965 aa] C 18.2
/38.4
11
/77
spike glycoprotein
6u7h[3] A spike glycoprotein[965 aa] B 31.5
/38.4
54
/76
spike glycoprotein
6ixb[6] B SPIKE_CVH22 Spike glycoprotein[964 aa] C 37.5
/38.5
16
/75
SPIKE_CVH22 Spike glycoprotein
6ixb[6] C SPIKE_CVH22 Spike glycoprotein[964 aa] B 24.1
/38.5
54
/66
SPIKE_CVH22 Spike glycoprotein
5x5f[9] B W6A028_9BETC S protein[1141 aa] C 38.5
/37.0
78
/96
W6A028_9BETC S protein
6q05[15] C K0BRG7_9BETC Spike glycoprotein[1159 aa] A 38.8
/37.8
85
/110
K0BRG7_9BETC Spike glycoprotein
6nb4[15] A A0A140AYW5_9BETC Spike glycoprotein[1169 aa] C 28.0
/44.6
50
/77
A0A140AYW5_9BETC Spike glycoprotein
5x5c[9] A W6A028_9BETC S protein[1141 aa] C 34.7
/37.0
75
/80
W6A028_9BETC S protein
6nb4[1] C A0A140AYW5_9BETC Spike glycoprotein[959 aa] B 28.6
/44.6
42
/73
A0A140AYW5_9BETC Spike glycoprotein
6nb4[1] C A0A140AYW5_9BETC Spike glycoprotein[959 aa] A 35.7
/37.4
70
/79
A0A140AYW5_9BETC Spike glycoprotein
6nb3[2] F A0A140AYW5_9BETC Spike glycoprotein[958 aa] G 36.9
/37.4
65
/75
A0A140AYW5_9BETC Spike glycoprotein
6nb3[2] F A0A140AYW5_9BETC Spike glycoprotein[958 aa] A 26.5
/37.4
83
/94
A0A140AYW5_9BETC Spike glycoprotein
6b7n[3] A A0A075E3D7_9NIDO Spike protein[966 aa] B 29.5
/36.9
78
/105
A0A075E3D7_9NIDO Spike protein
6bfu[3] C A0A140ES81_9NIDO Spike protein[964 aa] B 29.4
/37.1
85
/113
A0A140ES81_9NIDO Spike protein
6b7n[3] B A0A075E3D7_9NIDO Spike protein[966 aa] A 23.9
/36.9
67
/97
A0A075E3D7_9NIDO Spike protein
6bfu[3] B A0A140ES81_9NIDO Spike protein[964 aa] C 21.1
/37.1
76
/117
A0A140ES81_9NIDO Spike protein
6m16[3] B A0A2P1G1L3_9NIDO Spike glycoprotein[965 aa] A 31.2
/36.4
48
/80
A0A2P1G1L3_9NIDO Spike glycoprotein
6m16[3] A A0A2P1G1L3_9NIDO Spike glycoprotein[965 aa] B 42.3
/36.4
71
/95
A0A2P1G1L3_9NIDO Spike glycoprotein
5i08[3] A SPIKE_CVHN5 WAC_BPT4 Spike glycoprotein,Foldon chimera[958 aa] B 37.7
/36.3
61
/75
SPIKE_CVHN5 WAC_BPT4 Spike glycoprotein,Foldon chimera
5i08[3] C SPIKE_CVHN5 WAC_BPT4 Spike glycoprotein,Foldon chimera[958 aa] B 30.4
/36.3
56
/63
SPIKE_CVHN5 WAC_BPT4 Spike glycoprotein,Foldon chimera
6jx7[3] A Feline Infectious Peritonitis Virus Spike Protein[.. B 17.9
/35.4
67
/107
Feline Infectious Peritonitis Virus Spike Protein
6jx7[3] C Feline Infectious Peritonitis Virus Spike Protein[.. B 29.5
/35.4
78
/111
Feline Infectious Peritonitis Virus Spike Protein
6ohw[6] B Q696P8_CVHOC Spike surface glycoprotein[1175 aa] A 22.1
/34.9
95
/107
Q696P8_CVHOC Spike surface glycoprotein
6ohw[6] A Q696P8_CVHOC Spike surface glycoprotein[1175 aa] B 39.1
/34.9
110
/117
Q696P8_CVHOC Spike surface glycoprotein
5szs[3] B SPIKE_CVHNL Spike glycoprotein[1177 aa] A 24.6
/34.0
69
/81
SPIKE_CVHNL Spike glycoprotein
5szs[3] C SPIKE_CVHNL Spike glycoprotein[1177 aa] A 32.4
/34.0
68
/86
SPIKE_CVHNL Spike glycoprotein
6vsj[3] E SPIKE_CVMA5 Spike glycoprotein[1122 aa] A 28.2
/33.8
85
/93
SPIKE_CVMA5 Spike glycoprotein
6vsj[3] C SPIKE_CVMA5 Spike glycoprotein[1122 aa] A 34.4
/33.8
90
/92
SPIKE_CVMA5 Spike glycoprotein
3jcl[3] B SPIKE_CVMA5 Spike glycoprotein[1067 aa] A 38.6
/34.1
57
/57
SPIKE_CVMA5 Spike glycoprotein
3jcl[3] A SPIKE_CVMA5 Spike glycoprotein[1067 aa] B 25.4
/34.1
59
/60
SPIKE_CVMA5 Spike glycoprotein
6m15[3] B A8JNZ2_9ALPC Spike glycoprotein[965 aa] C 38.0
/33.6
79
/107
A8JNZ2_9ALPC Spike glycoprotein
6m15[3] B A8JNZ2_9ALPC Spike glycoprotein[965 aa] A 30.6
/33.6
72
/95
A8JNZ2_9ALPC Spike glycoprotein
5w9l[21] H W5ZZF5_9BETC Spike glycoprotein[726 aa] B 34.8
/46.9
23
/24
W5ZZF5_9BETC Spike glycoprotein
5w9n[21] H W5ZZF5_9BETC MERS S[726 aa] I 25.0
/27.9
4
/11
W5ZZF5_9BETC MERS S
5w9n[21] H W5ZZF5_9BETC MERS S[726 aa] J 35.3
/27.9
17
/22
W5ZZF5_9BETC MERS S
5w9j[3] L W5ZZF5_9BETC Spike glycoprotein[726 aa] G 100.0
/46.9
1
/12
W5ZZF5_9BETC Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
1255 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1zv8[1] R ACT
ACETATE ION[4 atoms]
G 100.0
/100.0
1
/1
VGL2_CVHSA E2 glycoprotein
6yz5[1] K ACT
ACETATE ION[4 atoms]
A 33.3
/74.2
3
/3
SPIKE_SARS2 Spike glycoprotein
6yz5[1] L ACT
ACETATE ION[4 atoms]
A 75.0
/74.2
4
/4
SPIKE_SARS2 Spike glycoprotein
1zv8[1] R ACT
ACETATE ION[4 atoms]
H 100.0
/100.0
2
/2
VGL2_CVHSA E2 glycoprotein
1zv8[1] O CAC
CACODYLATE ION[5 atoms]
H 100.0
/100.0
1
/1
VGL2_CVHSA E2 glycoprotein
1zv8[1] O CAC
CACODYLATE ION[5 atoms]
G 100.0
/100.0
1
/1
VGL2_CVHSA E2 glycoprotein
6lxt[2] I PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 100.0
/92.2
3
/3
SPIKE_SARS2 SPIKE_SARS2 Spike protein S2, Spike protein S2
6zp2[3] RA EIC
LINOLEIC ACID[20 atoms]
A 93.3
/77.4
15
/15
SPIKE_SARS2 Spike glycoprotein
6zp2[3] QA EIC
LINOLEIC ACID[20 atoms]
B 100.0
/77.4
2
/2
SPIKE_SARS2 Spike glycoprotein
6yla[2] N MLI
MALONATE ION[7 atoms]
A 100.0
/74.7
1
/1
SPIKE_SARS2 Spike glycoprotein
6yla[1] I MLI
MALONATE ION[7 atoms]
A 33.3
/74.7
3
/3
SPIKE_SARS2 Spike glycoprotein
6yla[1] K DMS
DIMETHYL SULFOXIDE[4 atoms]
A 33.3
/74.7
3
/3
SPIKE_SARS2 Spike glycoprotein
6zow[3] BB DMS
DIMETHYL SULFOXIDE[4 atoms]
D 100.0
/73.8
5
/5
SPIKE_SARS2 Spike glycoprotein
6zp7[3] LA DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/79.5
5
/5
SPIKE_SARS2 Spike glycoprotein
6yla[2] T DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/74.7
3
/3
SPIKE_SARS2 Spike glycoprotein
6zow[3] YA DMS
DIMETHYL SULFOXIDE[4 atoms]
D 75.0
/73.8
4
/4
SPIKE_SARS2 Spike glycoprotein
6yla[1] J DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/74.7
3
/3
SPIKE_SARS2 Spike glycoprotein
6yla[2] G DMS
DIMETHYL SULFOXIDE[4 atoms]
A 80.0
/74.7
5
/5
SPIKE_SARS2 Spike glycoprotein
6yla[2] Y DMS
DIMETHYL SULFOXIDE[4 atoms]
D 100.0
/74.2
3
/3
SPIKE_SARS2 Spike glycoprotein
6yla[1] IA DMS
DIMETHYL SULFOXIDE[4 atoms]
D 100.0
/74.2
1
/1
SPIKE_SARS2 Spike glycoprotein
6yz5[3] D EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/74.2
2
/2
SPIKE_SARS2 Spike glycoprotein
6yz5[1] M EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/74.2
7
/7
SPIKE_SARS2 Spike glycoprotein
6yz5[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/74.2
1
/1
SPIKE_SARS2 Spike glycoprotein
6yz5[1] Q EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/74.2
1
/1
SPIKE_SARS2 Spike glycoprotein
6yz5[1] I EDO
1,2-ETHANEDIOL[4 atoms]
A 75.0
/74.2
4
/4
SPIKE_SARS2 Spike glycoprotein
6yz5[1] N EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/74.2
4
/4
SPIKE_SARS2 Spike glycoprotein
6yz5[1] J EDO
1,2-ETHANEDIOL[4 atoms]
A 80.0
/74.2
5
/5
SPIKE_SARS2 Spike glycoprotein
6yz5[1] P EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/74.2
2
/2
SPIKE_SARS2 Spike glycoprotein
6yz5[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/74.2
6
/6
SPIKE_SARS2 Spike glycoprotein
6yz5[1] O EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/74.2
3
/3
SPIKE_SARS2 Spike glycoprotein
7c8w[2] D GOL
GLYCEROL[6 atoms]
B 75.0
/74.2
4
/4
SPIKE_SARS2 Spike glycoprotein
7c8v[1] D GOL
GLYCEROL[6 atoms]
B 0.0
/74.1
2
/2
SPIKE_SARS2 Spike glycoprotein
7c8v[1] C GOL
GLYCEROL[6 atoms]
B 100.0
/74.1
1
/1
SPIKE_SARS2 Spike glycoprotein
7c8v[1] J GOL
GLYCEROL[6 atoms]
B 100.0
/74.1
5
/5
SPIKE_SARS2 Spike glycoprotein
7c8v[1] E GOL
GLYCEROL[6 atoms]
B 33.3
/74.1
3
/3
SPIKE_SARS2 Spike glycoprotein
2bez[3] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
4
/4
SPIKE_CVHSA Spike glycoprotein
7c8v[1] H GOL
GLYCEROL[6 atoms]
B 100.0
/74.1
3
/3
SPIKE_SARS2 Spike glycoprotein
7c8v[1] K GOL
GLYCEROL[6 atoms]
B 100.0
/74.1
2
/2
SPIKE_SARS2 Spike glycoprotein
7c8v[1] G GOL
GLYCEROL[6 atoms]
B 75.0
/74.1
4
/4
SPIKE_SARS2 Spike glycoprotein
7c8v[1] I GOL
GLYCEROL[6 atoms]
B 100.0
/74.1
1
/1
SPIKE_SARS2 Spike glycoprotein
4njl[3] B PGE
TRIETHYLENE GLYCOL[10 atoms]
A 0.0
/50.8
2
/2
R9UQ53_9BETC S protein
4njl[3] B PGE
TRIETHYLENE GLYCOL[10 atoms]
A 0.0
/50.8
3
/3
R9UQ53_9BETC S protein
6vv5[2] NA PAM
PALMITOLEIC ACID[18 atoms]
B 57.1
/40.7
7
/7
S5RJN4_9ALPC Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.