[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
55910 422 111 P59595(NCAP_CVHSA) RecName: Full=Nucleoprotein {ECO:0000255|HAMAP-Rule:MF_04096};AltName: Full=Nucleocapsid protein {ECO:0000255|HAMAP-Rule:MF_04096}; Short=NC {ECO:0000255|HAMAP-Rule:MF_04096}; Short=Protein N {ECO:0000255|HAMAP-Rule:MF_04096};
QUERYSEQ
MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTR
NPNNNAATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYK
HWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADSTQA
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59595(NCAP_CVHSA)]

422
region name description
1-422 CHAIN /note="Nucleoprotein" /id="PRO_0000106003"
42-187 REGION /note="RNA-binding"
45-181 REGION /note="RNA-binding"
259-362 REGION /note="Dimerization"
181-213 COMPBIAS /note="Ser-rich"
220-225 COMPBIAS /note="Poly-Leu"
240-245 COMPBIAS /note="Poly-Gln"
370-376 COMPBIAS /note="Poly-Lys"
1-422 DISORDER predicted by DISOPRED (1-46,177-218,233-260,369-396,410-422)

MONOMER
422
pdb_id a1 identity[%]2 description
1ssk A 99.3 NCAP_CVHSA Nucleocapsid protein
2jw8 B 100.0 NCAP_CVHSA Nucleocapsid protein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1x7q[1] A 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha.. C 100.0
/100.0
9
/9
NCAP_CVHSA SARS NUCLEOCAPSID PEPTIDE
3i6l[1] A 1A24_HUMAN HLA class I histocompatibility antigen, A-24 alpha.. C 100.0
/100.0
9
/9
NCAP_CVHSA Nucleoprotein peptide
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6kl5[1] E DJO
(phenylmethyl) (2S)-2-(hydroxymethyl)-2,3-dihydroi..
C 50.0
/62.1
4
/4
A0A0D3MU65_9BETC Nucleoprotein
6kl5[1] E DJO
(phenylmethyl) (2S)-2-(hydroxymethyl)-2,3-dihydroi..
A 75.0
/60.5
4
/4
A0A0D3MU65_9BETC Nucleoprotein
6kl6[1] E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth..
D 57.1
/62.2
7
/7
A0A0D3MU65_9BETC Nucleoprotein
6kl6[1] E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth..
B 83.3
/60.3
6
/6
A0A0D3MU65_9BETC Nucleoprotein
4lm7[1] B U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms]
A 80.0
/49.2
10
/14
Q6SA23_CVHOC Nucleoprotein
4li4[1] B AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 80.0
/49.2
10
/14
Q6SA23_CVHOC Nucleoprotein
4lmt[1] B CQD
6-chloro-7-{[2-(morpholin-4-yl)ethyl]amino}quinoli..
A 83.3
/48.8
6
/10
Q6SA23_CVHOC Nucleoprotein
4lmc[1] B C5P
CYTIDINE-5'-MONOPHOSPHATE[21 atoms]
A 88.9
/48.8
9
/13
Q6SA23_CVHOC Nucleoprotein
4lm9[1] B 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms]
A 80.0
/48.8
10
/14
Q6SA23_CVHOC Nucleoprotein
4kxj[1] B P34
N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTH..
A 50.0
/48.4
6
/10
Q6SA23_CVHOC Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6wji[4] H CL
CHLORIDE ION[1 atoms]
A 100.0
/95.4
1
/1
NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
6wji[6] N CL
CHLORIDE ION[1 atoms]
F 100.0
/95.4
1
/1
NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
6g13[1] I CL
CHLORIDE ION[1 atoms]
B 50.0
/54.2
2
/2
A0A0D3MU51_9BETC Nucleoprotein
6wji[3] K CL
CHLORIDE ION[1 atoms]
D 100.0
/95.4
2
/2
NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
6vyo[4] O CL
CHLORIDE ION[1 atoms]
D 100.0
/92.0
5
/5
NCAP_SARS2 Nucleoprotein
6vyo[4] I CL
CHLORIDE ION[1 atoms]
D 100.0
/92.0
1
/1
NCAP_SARS2 Nucleoprotein
6vyo[8] H ZN
ZINC ION[1 atoms]
A 66.7
/91.9
3
/3
NCAP_SARS2 Nucleoprotein
6wkp[8] H ZN
ZINC ION[1 atoms]
B 100.0
/92.3
1
/1
NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
4ud1[3] N NH4
AMMONIUM ION[1 atoms]
E 0.0
/60.9
2
/2
T2B9R0_9BETC N PROTEIN
4ud1[1] J NH4
AMMONIUM ION[1 atoms]
C 100.0
/58.3
1
/1
T2B9R0_9BETC N PROTEIN
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2cjr[42] H NCAP_CVHSA NUCLEOCAPSID PROTEIN[110 aa] G 100.0
/100.0
49
/49
NCAP_CVHSA NUCLEOCAPSID PROTEIN
2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] B 100.0
/100.0
3
/3
NCAP_CVHSA Nucleocapsid protein
2gib[2] B NCAP_CVHSA Nucleocapsid protein[96 aa] A 100.0
/100.0
1
/1
NCAP_CVHSA Nucleocapsid protein
2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] A 100.0
/100.0
8
/8
NCAP_CVHSA Nucleocapsid protein
2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] A 100.0
/100.0
6
/6
NCAP_CVHSA Nucleocapsid protein
6wkp[1] A NCAP_SARS2 SARS-CoV-2 nucleocapsid protein[103 aa] B 87.5
/92.3
8
/8
NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
6wkp[1] A NCAP_SARS2 SARS-CoV-2 nucleocapsid protein[103 aa] D 100.0
/92.2
6
/6
NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
6wkp[7] D NCAP_SARS2 SARS-CoV-2 nucleocapsid protein[115 aa] C 92.9
/91.7
14
/14
NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
6vyo[7] A NCAP_SARS2 Nucleoprotein[124 aa] B 83.3
/92.0
12
/12
NCAP_SARS2 Nucleoprotein
6kl2[12] A A0A0D3MU65_9BETC Nucleoprotein[116 aa] C 54.5
/62.5
11
/11
A0A0D3MU65_9BETC Nucleoprotein
6g13[4] B A0A0D3MU51_9BETC Nucleoprotein[113 aa] D 58.6
/54.2
58
/58
A0A0D3MU51_9BETC Nucleoprotein
5n4k[2] A NCAP_CVHNL Nucleoprotein[130 aa] B 33.3
/47.3
12
/22
NCAP_CVHNL Nucleoprotein
2gec[1] B NCAP_IBVG Nucleocapsid protein[139 aa] A 27.8
/41.3
18
/18
NCAP_IBVG Nucleocapsid protein
2gec[1] A NCAP_IBVG Nucleocapsid protein[138 aa] B 36.8
/41.3
19
/25
NCAP_IBVG Nucleocapsid protein
5epw[2] B NCAP_CVHNL Nucleoprotein[110 aa] A 32.6
/40.0
43
/54
NCAP_CVHNL Nucleoprotein
2ge8[11] A NCAP_IBVG Nucleocapsid protein[112 aa] B 34.5
/30.1
55
/57
NCAP_IBVG Nucleocapsid protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2ofz[1] B EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
NCAP_CVHSA Nucleocapsid protein
5n4k[4] N SO4
SULFATE ION[5 atoms]
B 33.3
/47.3
3
/3
NCAP_CVHNL Nucleoprotein
6wzq[3] J SO4
SULFATE ION[5 atoms]
D 100.0
/95.7
1
/1
NCAP_SARS2 Nucleoprotein
2gib[5] C SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
NCAP_CVHSA Nucleocapsid protein
5n4k[3] P SO4
SULFATE ION[5 atoms]
B 66.7
/47.3
3
/5
NCAP_CVHNL Nucleoprotein
5n4k[1] I SO4
SULFATE ION[5 atoms]
A 50.0
/45.5
2
/2
NCAP_CVHNL Nucleoprotein
5n4k[2] N SO4
SULFATE ION[5 atoms]
A 0.0
/45.5
1
/1
NCAP_CVHNL Nucleoprotein
1x7q[1] E SO4
SULFATE ION[5 atoms]
C 100.0
/100.0
1
/1
NCAP_CVHSA SARS NUCLEOCAPSID PEPTIDE
6wzq[1] I SO4
SULFATE ION[5 atoms]
C 100.0
/95.7
3
/3
NCAP_SARS2 Nucleoprotein
6wzq[1] F SO4
SULFATE ION[5 atoms]
A 100.0
/95.6
1
/1
NCAP_SARS2 Nucleoprotein
7c22[2] G ACT
ACETATE ION[4 atoms]
D 100.0
/95.4
1
/1
NCAP_SARS2 Nucleoprotein
7c22[2] G ACT
ACETATE ION[4 atoms]
C 100.0
/95.5
3
/3
NCAP_SARS2 Nucleoprotein
4ud1[2] L GOL
GLYCEROL[6 atoms]
C 33.3
/58.3
3
/3
T2B9R0_9BETC N PROTEIN
6vyo[2] K GOL
GLYCEROL[6 atoms]
B 100.0
/92.0
3
/3
NCAP_SARS2 Nucleoprotein
6vyo[2] P GOL
GLYCEROL[6 atoms]
C 83.3
/92.0
6
/6
NCAP_SARS2 Nucleoprotein
4ud1[1] M GOL
GLYCEROL[6 atoms]
D 0.0
/60.7
3
/3
T2B9R0_9BETC N PROTEIN
6wkp[6] F MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
B 100.0
/92.3
4
/4
NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
6vyo[6] G MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/91.9
3
/3
NCAP_SARS2 Nucleoprotein
4ud1[2] K IMD
IMIDAZOLE[5 atoms]
C 100.0
/58.3
1
/1
T2B9R0_9BETC N PROTEIN
7c22[1] F PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/95.4
3
/3
NCAP_SARS2 Nucleoprotein
6g13[1] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 80.0
/54.3
5
/5
A0A0D3MU51_9BETC Nucleoprotein
6g13[3] H TMO
trimethylamine oxide[5 atoms]
B 100.0
/54.2
3
/3
A0A0D3MU51_9BETC Nucleoprotein
6g13[1] E TMO
trimethylamine oxide[5 atoms]
A 0.0
/54.3
1
/1
A0A0D3MU51_9BETC Nucleoprotein
4j3k[1] B TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
A 44.4
/49.2
9
/9
Q6SA23_CVHOC Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.