[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
35711 221 2 P59596(VME1_CVHSA) RecName: Full=Membrane protein {ECO:0000255|HAMAP-Rule:MF_04202}; Short=M protein {ECO:0000255|HAMAP-Rule:MF_04202};AltName: Full=E1 glycoprotein {ECO:0000255|HAMAP-Rule:MF_04202};AltName: Full=Matrix glycoprotein {ECO:0000255|HAMAP-Rule:MF_04202};AltName: Full=Membrane glycoprotein {ECO:0000255|HAMAP-Rule:MF_04202};
QUERYSEQ
MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRM
AGHSLGRCDIKDLPKEITVATSRTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59596(VME1_CVHSA)]

221
region name description
1-221 CHAIN /note="Membrane protein" /id="PRO_0000106035"
1-18 TOPO_DOM /note="Virion surface"
19-39 TRANSMEM /note="Helical"
40-49 TOPO_DOM /note="Intravirion"
50-70 TRANSMEM /note="Helical"
71-78 TOPO_DOM /note="Virion surface"
79-99 TRANSMEM /note="Helical"
100-221 TOPO_DOM /note="Intravirion"
1-6 DISORDER predicted by DISOPRED (1-6)

MONOMER
221
pdb_id a1 identity[%]2 description
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
221 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3i6g[2] A 1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha .. C 100.0
/100.0
8
/8
VME1_CVHSA Membrane protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.