[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
36384 154 0 P59633(NS3B_CVHSA) RecName: Full=Non-structural protein 3b; Short=ns3b;AltName: Full=Accessory protein 3b;AltName: Full=Protein X2;
QUERYSEQ
MMPTTLFAGTHITMTTVYHITVSQIQLSLLKVTAFQHQNSKKTTKLVVILRIGTQVLKTMSLYMAISPKFTTSLSLHKLLQTLVLKMLHSSSLTSLLKTHRMCKYTQSTALQELLIQQWIQFMMSRRRLLACLCKHKKVSTNLCTHSFRK
KQVR
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59633(NS3B_CVHSA)]

154
region name description
1-154 CHAIN /note="Non-structural protein 3b" /id="PRO_0000106132"
80-138 REGION /note="Mitochondrial targeting signal"
134-154 REGION /note="Nucleolar targeting"
1-154 DISORDER predicted by DISOPRED (1-2,153-154)

No homologue is found in PDB.

Please check [SiteTable] for homologues.