[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57369 63 0 P59634(NS6_CVHSA) RecName: Full=ORF6 protein;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3;
QUERYSEQ
MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPLTKKNYSELDDEEPMELDYP
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59634(NS6_CVHSA)]

63
region name description
1-63 CHAIN /note="ORF6 protein" /id="PRO_0000106134"
54-63 REGION /note="Critical for disrupting nuclear import"

No homologue is found in PDB.

Please check [SiteTable] for homologues.