[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57834 122 3 P59635(NS7A_CVHSA) RecName: Full=ORF7a protein;AltName: Full=Accessory protein 7a;AltName: Full=Protein U122;AltName: Full=Protein X4;Flags: Precursor;
QUERYSEQ
MKIILFLTLIVFTSCELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59635(NS7A_CVHSA)]

122
region name description
1-15 SIGNAL
16-122 CHAIN /note="ORF7a protein" /id="PRO_0000037435"
16-96 TOPO_DOM /note="Virion surface"
97-117 TRANSMEM /note="Helical"
118-122 TOPO_DOM /note="Intravirion"
16-81 DOMAIN /note="X4e"
1-122 DISORDER predicted by DISOPRED (1-10,122-122)

MONOMER
122
pdb_id a1 identity[%]2 description
1yo4 A 100.0 YX4_CVHSA Hypothetical protein X4
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.