[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
36874 425 80 P84022(SMAD3_HUMAN) RecName: Full=Mothers against decapentaplegic homolog 3; Short=MAD homolog 3; Short=Mad3; Short=Mothers against DPP homolog 3; Short=hMAD-3;AltName: Full=JV15-2;AltName: Full=SMAD family member 3; Short=SMAD 3; Short=Smad3; Short=hSMAD3;
QUERYSEQ
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEF
PPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P84022(SMAD3_HUMAN)]

425
region name description
2-425 CHAIN /note="Mothers against decapentaplegic homolog 3" /id="PRO_0000090856"
10-136 DOMAIN /note="MH1"
232-425 DOMAIN /note="MH2"
137-231 REGION /note="Linker"
271-324 REGION /note="Sufficient for interaction with XPO4"
64-64 METAL /note="Zinc"
109-109 METAL /note="Zinc"
121-121 METAL /note="Zinc"
126-126 METAL /note="Zinc"
1-425 DISORDER predicted by DISOPRED (1-9,27-28,32-32,34-34,172-174,176-211,417-425)

MONOMER
425
pdb_id a1 identity[%]2 description
1mk2 A 100.0 SMAD3_HUMAN SMAD 3
1ozj C 100.0 SMAD3_HUMAN SMAD 3
2laj B 80.0 SMAD3_HUMAN Mothers against decapentaplegic homolog 3
2lb2 B 91.7 SMAD3_HUMAN Mothers against decapentaplegic homolog 3
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
425 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5xoc[3] B THIO_ECOLI FOXH1_HUMAN Thioredoxin 1,Forkhead box protein H1[133 aa] A 100.0
/100.0
26
/26
SMAD3_HUMAN Mothers against decapentaplegic homolog 3
1dev[4] D ZFYV9_HUMAN Smad anchor for receptor activation[39 aa] C 100.0
/97.4
32
/32
SMAD2_HUMAN MAD (mothers against decapentaplegic, Drosophila) ..
5zoj[1] E MAN1_HUMAN Inner nuclear membrane protein Man1[116 aa] B 100.0
/97.8
15
/15
SMAD2_HUMAN Mothers against decapentaplegic homolog 2
5xod[3] B SKI_HUMAN Ski oncogene[22 aa] A 100.0
/97.4
20
/20
SMAD2_HUMAN Mothers against decapentaplegic homolog 2
1u7f[2] B SMAD4_HUMAN Mothers against decapentaplegic homolog 4[193 aa] A 96.3
/100.0
27
/28
SMAD3_HUMAN Mothers against decapentaplegic homolog 3
1u7f[2] B SMAD4_HUMAN Mothers against decapentaplegic homolog 4[193 aa] C 100.0
/100.0
20
/20
SMAD3_HUMAN Mothers against decapentaplegic homolog 3
2lb2[1] A NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like[35 aa] B 90.9
/91.7
11
/11
SMAD3_HUMAN Mothers against decapentaplegic homolog 3
5zok[7] D MAN1_HUMAN Inner nuclear membrane protein Man1[124 aa] C 66.7
/80.5
9
/9
SMAD1_HUMAN Mothers against decapentaplegic homolog 1
2laj[1] A NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like[40 aa] B 66.7
/80.0
6
/6
SMAD3_HUMAN Mothers against decapentaplegic homolog 3
5c4v[3] E SKIL_HUMAN Ski-like protein[91 aa] B 41.2
/53.6
17
/18
SMAD4_HUMAN Mothers against decapentaplegic homolog 4
1mr1[2] D SKI_HUMAN Ski oncogene[96 aa] A 35.3
/53.2
17
/17
SMAD4_HUMAN Mothers against decapentaplegic homolog 4
1u7f[2] C SMAD3_HUMAN Mothers against decapentaplegic homolog 3[196 aa] B 60.0
/53.3
20
/23
SMAD4_HUMAN Mothers against decapentaplegic homolog 4
1u7f[2] A SMAD3_HUMAN Mothers against decapentaplegic homolog 3[198 aa] B 68.0
/53.3
25
/25
SMAD4_HUMAN Mothers against decapentaplegic homolog 4
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
425 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1mhd[2] A DNA D 100.0
/100.0
3
/3
SMAD3_HUMAN SMAD3
5odg[4] C DNA (5'-D(P*CP*AP*GP*GP*CP*TP*AP*GP*CP*CP*TP*GP*CP.. B 100.0
/100.0
3
/3
SMAD3_HUMAN Mothers against decapentaplegic homolog 3
5odg[4] D DNA (5'-D(P*CP*AP*GP*GP*CP*TP*AP*GP*CP*CP*TP*GP*CP.. B 100.0
/100.0
11
/11
SMAD3_HUMAN Mothers against decapentaplegic homolog 3
1mhd[1] B DNA D 100.0
/100.0
7
/7
SMAD3_HUMAN SMAD3
1mhd[1] B DNA C 100.0
/100.0
4
/4
SMAD3_HUMAN SMAD3
1ozj[2] A Smad binding element C 100.0
/100.0
10
/10
SMAD3_HUMAN SMAD 3
6h3r[4] C DNA (5'-D(P*GP*AP*GP*TP*GP*TP*CP*TP*GP*CP*AP*GP*AP.. B 100.0
/89.3
5
/5
B7Z5N5_HUMAN Mothers against decapentaplegic homolog
6tbz[4] B DNA (5'-D(P*TP*GP*CP*AP*GP*GP*CP*GP*CP*GP*CP*CP*TP.. A 100.0
/73.6
9
/9
SMAD5_HUMAN Mothers against decapentaplegic homolog 5
6fzs[2] D DNA (5'-D(P*TP*GP*CP*AP*GP*GP*CP*GP*CP*GP*CP*CP*TP.. A 100.0
/71.0
4
/4
SMAD5_HUMAN Mothers against decapentaplegic homolog 5
6fzt[4] D DNA (5'-D(P*TP*GP*CP*AP*GP*GP*CP*GP*CP*GP*CP*CP*TP.. A 100.0
/73.8
3
/3
SMAD9_HUMAN Mothers against decapentaplegic homolog 9
5od6[2] C DNA (5'-D(P*TP*GP*CP*AP*GP*GP*CP*GP*CP*GP*CP*CP*TP.. A 100.0
/100.0
5
/5
SMAD3_HUMAN Mothers against decapentaplegic homolog 3
6tce[4] B DNA (5'-D(P*TP*GP*CP*AP*GP*GP*CP*TP*AP*GP*CP*CP*TP.. A 100.0
/71.9
4
/4
SMAD5_HUMAN Mothers against decapentaplegic homolog 5
5x6h[2] B DNA (5'-D(P*GP*TP*AP*TP*GP*GP*CP*GP*CP*CP*AP*TP*AP.. A 100.0
/71.7
4
/4
SMAD5_MOUSE Mothers against decapentaplegic homolog 5
5x6h[2] B DNA (5'-D(P*GP*TP*AP*TP*GP*GP*CP*GP*CP*CP*AP*TP*AP.. A 100.0
/71.7
9
/9
SMAD5_MOUSE Mothers against decapentaplegic homolog 5
5x6m[2] C DNA (5'-D(P*TP*TP*AP*TP*AP*GP*AP*CP*TP*GP*CP*CP*GP.. D 100.0
/70.8
4
/4
SMAD5_MOUSE Mothers against decapentaplegic homolog 5
5x6m[2] G DNA (5'-D(P*TP*TP*AP*TP*AP*GP*AP*CP*TP*GP*CP*CP*GP.. E 100.0
/70.8
10
/10
SMAD5_MOUSE Mothers against decapentaplegic homolog 5
5x6m[4] F DNA (5'-D(P*AP*TP*CP*AP*GP*AP*CP*TP*GP*CP*CP*GP*GP.. E 100.0
/70.8
5
/5
SMAD5_MOUSE Mothers against decapentaplegic homolog 5
1ozj[2] B Smad binding element D 100.0
/100.0
9
/9
SMAD3_HUMAN SMAD 3
3kmp[2] D 5'-D(P*GP*TP*AP*TP*GP*TP*CP*TP*AP*GP*AP*CP*TP*GP*A.. B 100.0
/70.5
7
/7
Q8CC31_MOUSE SMAD1-MH1
3kmp[1] C 5'-D(P*AP*TP*CP*AP*GP*TP*CP*TP*AP*GP*AP*CP*AP*TP*A.. B 100.0
/70.5
5
/5
Q8CC31_MOUSE SMAD1-MH1
3kmp[1] C 5'-D(P*AP*TP*CP*AP*GP*TP*CP*TP*AP*GP*AP*CP*AP*TP*A.. A 87.5
/70.7
8
/8
Q8CC31_MOUSE SMAD1-MH1
5x6g[2] D DNA (5'-D(P*GP*TP*AP*TP*GP*TP*CP*TP*AP*GP*AP*CP*TP.. A 100.0
/71.1
3
/3
SMAD5_MOUSE Mothers against decapentaplegic homolog 5
5x6g[1] C DNA (5'-D(P*AP*TP*CP*AP*GP*TP*CP*TP*AP*GP*AP*CP*AP.. A 87.5
/71.1
8
/8
SMAD5_MOUSE Mothers against decapentaplegic homolog 5
5x6g[1] C DNA (5'-D(P*AP*TP*CP*AP*GP*TP*CP*TP*AP*GP*AP*CP*AP.. B 100.0
/70.5
5
/5
SMAD5_MOUSE Mothers against decapentaplegic homolog 5
5nm9[10] C DNA (5'-D(P*AP*TP*GP*CP*GP*GP*GP*CP*GP*CP*GP*CP*CP.. A 62.5
/59.8
8
/8
B3S7S5_TRIAD Mothers against decapentaplegic homolog
5mey[2] B DNA (5'-D(P*AP*TP*GP*CP*GP*GP*GP*CP*GP*CP*GP*CP*CP.. A 100.0
/57.4
3
/3
SMAD4_HUMAN MH1 domain of human Smad4
5mf0[4] C DNA (5'-D(P*AP*CP*GP*GP*GP*CP*CP*GP*CP*GP*GP*CP*CP.. A 72.7
/57.4
11
/11
SMAD4_HUMAN MH1 domain of human Smad4
3qsv[8] H DNA (5'-D(P*TP*GP*CP*AP*GP*TP*CP*TP*AP*GP*AP*CP*TP.. C 62.5
/57.4
8
/8
SMAD4_MOUSE Mothers against decapentaplegic homolog 4
5mez[2] D DNA (5'-D(P*GP*CP*AP*GP*GP*CP*TP*AP*GP*CP*CP*TP*GP.. A 100.0
/56.8
4
/4
SMAD4_HUMAN MH1 domain of human Smad4
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
425 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1ozj[2] F ZN
ZINC ION[1 atoms]
D 100.0
/100.0
4
/4
SMAD3_HUMAN SMAD 3
5mez[14] E ZN
ZINC ION[1 atoms]
A 100.0
/56.8
4
/4
SMAD4_HUMAN MH1 domain of human Smad4
3kmp[2] E ZN
ZINC ION[1 atoms]
A 100.0
/70.7
4
/4
Q8CC31_MOUSE SMAD1-MH1
6fzs[2] E ZN
ZINC ION[1 atoms]
A 100.0
/71.0
4
/4
SMAD5_HUMAN Mothers against decapentaplegic homolog 5
3qsv[4] K ZN
ZINC ION[1 atoms]
C 100.0
/57.4
4
/4
SMAD4_MOUSE Mothers against decapentaplegic homolog 4
5nm9[4] F ZN
ZINC ION[1 atoms]
B 100.0
/59.8
4
/4
B3S7S5_TRIAD Mothers against decapentaplegic homolog
6tbz[1] D ZN
ZINC ION[1 atoms]
A 100.0
/73.6
4
/4
SMAD5_HUMAN Mothers against decapentaplegic homolog 5
5odg[6] G ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
SMAD3_HUMAN Mothers against decapentaplegic homolog 3
6fzt[4] G ZN
ZINC ION[1 atoms]
B 100.0
/73.6
4
/4
SMAD9_HUMAN Mothers against decapentaplegic homolog 9
6tce[2] C ZN
ZINC ION[1 atoms]
A 100.0
/71.9
5
/5
SMAD5_HUMAN Mothers against decapentaplegic homolog 5
5mey[3] D CL
CHLORIDE ION[1 atoms]
A 40.0
/57.4
5
/5
SMAD4_HUMAN MH1 domain of human Smad4
5mey[2] G CL
CHLORIDE ION[1 atoms]
A 33.3
/57.4
3
/3
SMAD4_HUMAN MH1 domain of human Smad4
5mey[2] E CL
CHLORIDE ION[1 atoms]
A 66.7
/57.4
3
/3
SMAD4_HUMAN MH1 domain of human Smad4
5odg[2] F CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
SMAD3_HUMAN Mothers against decapentaplegic homolog 3
5mf0[4] H CL
CHLORIDE ION[1 atoms]
B 33.3
/57.4
3
/3
SMAD4_HUMAN MH1 domain of human Smad4
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
425 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5xod[6] A SMAD2_HUMAN Mothers against decapentaplegic homolog 2[193 aa] A 96.0
/97.4
25
/25
SMAD2_HUMAN Mothers against decapentaplegic homolog 2
5xoc[9] A SMAD3_HUMAN Mothers against decapentaplegic homolog 3[194 aa] A 100.0
/100.0
14
/14
SMAD3_HUMAN Mothers against decapentaplegic homolog 3
1mk2[2] A SMAD3_HUMAN SMAD 3[197 aa] A 100.0
/100.0
12
/12
SMAD3_HUMAN SMAD 3
5zoj[3] B SMAD2_HUMAN Mothers against decapentaplegic homolog 2[185 aa] C 100.0
/97.8
18
/18
SMAD2_HUMAN Mothers against decapentaplegic homolog 2
1khx[3] A SMAD2_HUMAN Smad2[203 aa] A 86.7
/96.5
30
/31
SMAD2_HUMAN Smad2
1u7f[2] A SMAD3_HUMAN Mothers against decapentaplegic homolog 3[198 aa] C 95.7
/100.0
23
/24
SMAD3_HUMAN Mothers against decapentaplegic homolog 3
1khx[3] A SMAD2_HUMAN Smad2[203 aa] A 96.3
/96.5
27
/27
SMAD2_HUMAN Smad2
1u7v[2] B SMAD2_HUMAN Mothers against decapentaplegic homolog 2[196 aa] A 100.0
/96.9
21
/21
SMAD2_HUMAN Mothers against decapentaplegic homolog 2
5od6[2] B SMAD3_HUMAN Mothers against decapentaplegic homolog 3[126 aa] A 100.0
/100.0
5
/5
SMAD3_HUMAN Mothers against decapentaplegic homolog 3
1ozj[2] C SMAD3_HUMAN SMAD 3[126 aa] D 100.0
/100.0
1
/1
SMAD3_HUMAN SMAD 3
5zok[6] C SMAD1_HUMAN Mothers against decapentaplegic homolog 1[200 aa] C 85.0
/80.5
20
/25
SMAD1_HUMAN Mothers against decapentaplegic homolog 1
1khu[6] A SMAD1_HUMAN SMAD1[198 aa] C 91.3
/79.9
23
/23
SMAD1_HUMAN SMAD1
5zok[6] C SMAD1_HUMAN Mothers against decapentaplegic homolog 1[200 aa] C 87.5
/80.5
24
/24
SMAD1_HUMAN Mothers against decapentaplegic homolog 1
1khu[6] D SMAD1_HUMAN SMAD1[184 aa] D 86.7
/80.8
15
/15
SMAD1_HUMAN SMAD1
3gmj[6] A MAD_DROME Protein mothers against dpp[199 aa] A 80.8
/78.3
26
/26
MAD_DROME Protein mothers against dpp
3gmj[6] A MAD_DROME Protein mothers against dpp[199 aa] A 88.0
/78.3
25
/25
MAD_DROME Protein mothers against dpp
5x6h[2] A SMAD5_MOUSE Mothers against decapentaplegic homolog 5[115 aa] A 100.0
/71.7
3
/3
SMAD5_MOUSE Mothers against decapentaplegic homolog 5
5x6m[4] E SMAD5_MOUSE Mothers against decapentaplegic homolog 5[121 aa] A 76.5
/71.1
17
/17
SMAD5_MOUSE Mothers against decapentaplegic homolog 5
5mez[2] B SMAD4_HUMAN MH1 domain of human Smad4[122 aa] A 30.0
/56.8
10
/10
SMAD4_HUMAN MH1 domain of human Smad4
1g88[3] A SMAD4_HUMAN SMAD4[221 aa] B 52.4
/50.5
21
/22
SMAD4_HUMAN SMAD4
1ygs[3] A SMA4_HUMAN SMAD4[190 aa] A 53.8
/53.2
13
/13
SMA4_HUMAN SMAD4
1ygs[3] A SMA4_HUMAN SMAD4[190 aa] A 75.0
/53.2
12
/12
SMA4_HUMAN SMAD4
1dd1[3] A SMAD4_HUMAN SMAD4[221 aa] C 73.3
/51.1
15
/15
SMAD4_HUMAN SMAD4
1g88[6] C SMAD4_HUMAN SMAD4[236 aa] B 70.6
/50.5
17
/17
SMAD4_HUMAN SMAD4
1dd1[2] B SMAD4_HUMAN SMAD4[249 aa] B 12.5
/51.1
8
/16
SMAD4_HUMAN SMAD4
1dd1[6] C SMAD4_HUMAN SMAD4[241 aa] A 60.0
/49.5
15
/15
SMAD4_HUMAN SMAD4
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
425 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1mk2[2] F ACY
ACETIC ACID[4 atoms]
A 100.0
/100.0
4
/4
SMAD3_HUMAN SMAD 3
1mk2[2] D ACY
ACETIC ACID[4 atoms]
A 100.0
/100.0
6
/6
SMAD3_HUMAN SMAD 3
1mk2[4] D ACY
ACETIC ACID[4 atoms]
A 100.0
/100.0
2
/2
SMAD3_HUMAN SMAD 3
1mk2[2] E ACY
ACETIC ACID[4 atoms]
A 100.0
/100.0
3
/3
SMAD3_HUMAN SMAD 3
6fzt[1] F GOL
GLYCEROL[6 atoms]
A 100.0
/73.8
4
/4
SMAD9_HUMAN Mothers against decapentaplegic homolog 9
5c4v[1] G GOL
GLYCEROL[6 atoms]
A 80.0
/53.3
5
/5
SMAD4_HUMAN Mothers against decapentaplegic homolog 4
3kmp[2] F GOL
GLYCEROL[6 atoms]
A 83.3
/70.7
6
/6
Q8CC31_MOUSE SMAD1-MH1
6fzt[1] H GOL
GLYCEROL[6 atoms]
B 100.0
/73.6
6
/6
SMAD9_HUMAN Mothers against decapentaplegic homolog 9
5mey[2] H PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 40.0
/57.4
5
/5
SMAD4_HUMAN MH1 domain of human Smad4
5mey[2] I PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/57.4
1
/1
SMAD4_HUMAN MH1 domain of human Smad4
1dd1[6] G SO4
SULFATE ION[5 atoms]
B 0.0
/51.1
2
/4
SMAD4_HUMAN SMAD4
1dd1[6] L SO4
SULFATE ION[5 atoms]
C 66.7
/51.1
3
/3
SMAD4_HUMAN SMAD4
1dd1[8] J SO4
SULFATE ION[5 atoms]
C 100.0
/51.1
2
/2
SMAD4_HUMAN SMAD4
1dd1[4] K SO4
SULFATE ION[5 atoms]
B 100.0
/51.1
4
/4
SMAD4_HUMAN SMAD4
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.