[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
36869 180 49 Q10589(BST2_HUMAN) RecName: Full=Bone marrow stromal antigen 2; Short=BST-2;AltName: Full=HM1.24 antigen;AltName: Full=Tetherin;AltName: CD_antigen=CD317;Flags: Precursor;
QUERYSEQ
MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIAD
KKYYPSSQDSSSAAAPQLLIVLLGLSALLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q10589(BST2_HUMAN)]

180
region name description
1-161 CHAIN /note="Bone marrow stromal antigen 2" /id="PRO_0000065005"
162-180 PROPEP /note="Removed in mature form" /id="PRO_0000253552"
1-20 TOPO_DOM /note="Cytoplasmic"
21-48 TRANSMEM /note="Helical; Signal-anchor for type II membrane protein"
49-161 TOPO_DOM /note="Extracellular"
68-152 COILED
161-161 LIPID /note="GPI-anchor amidated serine"
1-163 DISORDER predicted by DISOPRED (1-3,163-163)

MONOMER
180
pdb_id a1 identity[%]2 description
3mqb A 100.0 BST2_HUMAN Bone marrow stromal antigen 2
4p6z F 100.0 BST2_HUMAN Bone marrow stromal antigen 2
2lk9 A 100.0 BST2_HUMAN Bone marrow stromal antigen 2
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4p6z[1] C AP1M1_MOUSE AP-1 complex subunit mu-1[415 aa] F 100.0
/100.0
11
/11
BST2_HUMAN Bone marrow stromal antigen 2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2xg7[2] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
2xg7[2] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
2
/2
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2x7a[3] L NA
SODIUM ION[1 atoms]
B 100.0
/100.0
1
/1
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
2x7a[1] P NA
SODIUM ION[1 atoms]
E 100.0
/100.0
1
/1
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
2x7a[1] Z NA
SODIUM ION[1 atoms]
I 100.0
/100.0
1
/1
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
2x7a[1] U NA
SODIUM ION[1 atoms]
G 100.0
/100.0
2
/2
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
2x7a[2] X MG
MAGNESIUM ION[1 atoms]
J 100.0
/100.0
2
/2
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
2x7a[1] AA CL
CHLORIDE ION[1 atoms]
I 100.0
/100.0
1
/1
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
2x7a[1] O CL
CHLORIDE ION[1 atoms]
E 100.0
/100.0
1
/1
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
2x7a[1] T CL
CHLORIDE ION[1 atoms]
G 100.0
/100.0
3
/3
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
2x7a[1] W CL
CHLORIDE ION[1 atoms]
H 100.0
/100.0
1
/1
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
2x7a[1] M CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
1
/1
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
2x7a[1] Q CL
CHLORIDE ION[1 atoms]
F 100.0
/100.0
1
/1
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
2x7a[1] M CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
3mq7[4] M CA
CALCIUM ION[1 atoms]
E 100.0
/97.0
2
/2
BST2_HUMAN Bone marrow stromal antigen 2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2x7a[12] F BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[59 aa] E 100.0
/100.0
24
/24
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
2xg7[2] A BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[82 aa] B 100.0
/100.0
27
/27
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
3mq7[104] F BST2_HUMAN Bone marrow stromal antigen 2[99 aa] G 87.5
/97.0
16
/16
BST2_HUMAN Bone marrow stromal antigen 2
3mqb[38] C BST2_HUMAN Bone marrow stromal antigen 2[106 aa] D 100.0
/100.0
34
/34
BST2_HUMAN Bone marrow stromal antigen 2
3mq7[1] L BST2_HUMAN Bone marrow stromal antigen 2[99 aa] H 100.0
/97.0
7
/7
BST2_HUMAN Bone marrow stromal antigen 2
3mq7[2] K BST2_HUMAN Bone marrow stromal antigen 2[99 aa] H 100.0
/97.0
1
/1
BST2_HUMAN Bone marrow stromal antigen 2
3mq7[3] A BST2_HUMAN Bone marrow stromal antigen 2[99 aa] J 100.0
/97.0
1
/1
BST2_HUMAN Bone marrow stromal antigen 2
3mq7[6] A BST2_HUMAN Bone marrow stromal antigen 2[99 aa] F 85.7
/97.0
7
/7
BST2_HUMAN Bone marrow stromal antigen 2
3mq7[1] H BST2_HUMAN Bone marrow stromal antigen 2[99 aa] L 100.0
/97.0
7
/7
BST2_HUMAN Bone marrow stromal antigen 2
3mqb[3] C BST2_HUMAN Bone marrow stromal antigen 2[106 aa] A 100.0
/100.0
10
/10
BST2_HUMAN Bone marrow stromal antigen 2
3mq7[2] L BST2_HUMAN Bone marrow stromal antigen 2[99 aa] D 100.0
/97.0
1
/1
BST2_HUMAN Bone marrow stromal antigen 2
3mq7[1] D BST2_HUMAN Bone marrow stromal antigen 2[99 aa] L 100.0
/97.0
1
/1
BST2_HUMAN Bone marrow stromal antigen 2
3mq7[2] C BST2_HUMAN Bone marrow stromal antigen 2[99 aa] K 100.0
/97.0
2
/2
BST2_HUMAN Bone marrow stromal antigen 2
3mq7[1] H BST2_HUMAN Bone marrow stromal antigen 2[99 aa] K 100.0
/97.0
1
/1
BST2_HUMAN Bone marrow stromal antigen 2
3mq9[8] B MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. C 95.8
/96.6
24
/24
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin..
3mq9[8] D MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. C 87.5
/96.6
16
/20
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin..
3mq9[8] F MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. H 90.5
/96.6
21
/27
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin..
3ni0[2] A BST2_MOUSE Bone marrow stromal antigen 2[95 aa] B 65.8
/50.6
38
/41
BST2_MOUSE Bone marrow stromal antigen 2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2x7a[1] R GOL
GLYCEROL[6 atoms]
G 100.0
/100.0
1
/1
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2
3ni0[1] C IPA
ISOPROPYL ALCOHOL[4 atoms]
B 100.0
/50.6
1
/1
BST2_MOUSE Bone marrow stromal antigen 2
3ni0[1] C IPA
ISOPROPYL ALCOHOL[4 atoms]
A 0.0
/51.3
3
/3
BST2_MOUSE Bone marrow stromal antigen 2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.