[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57091 39 0 Q7TFA0(NS8A_CVHSA) RecName: Full=ORF8a protein;AltName: Full=Accessory protein 8a;AltName: Full=Protein non-structural 8a; Short=ns8a;Flags: Precursor;
QUERYSEQ
MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPCKVQH
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q7TFA0(NS8A_CVHSA)]

39
region name description
1-15 SIGNAL
1-1 DISORDER predicted by DISOPRED (1-1)

No homologue is found in PDB.

Please check [SiteTable] for homologues.