[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
35894 740 500 Q92499(DDX1_HUMAN) RecName: Full=ATP-dependent RNA helicase DDX1; EC=3.6.4.13 {ECO:0000269|PubMed:21589879};AltName: Full=DEAD box protein 1;AltName: Full=DEAD box protein retinoblastoma; Short=DBP-RB;
QUERYSEQ
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCHDQGLCRVGWS
TMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAE
QTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNP
KTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q92499(DDX1_HUMAN)]

740
region name description
1-740 CHAIN /note="ATP-dependent RNA helicase DDX1" /id="PRO_0000054986"
2-428 DOMAIN /note="Helicase ATP-binding"
70-247 DOMAIN /note="B30.2/SPRY"
493-681 DOMAIN /note="Helicase C-terminal"
46-53 NP_BIND /note="ATP"
1-525 REGION /note="Necessary for interaction with RELA"
1-448 REGION /note="Interaction with dsRNA"
1-295 REGION /note="Necessary for interaction with HNRNPK"
525-740 REGION /note="Necessary for interaction with HNRNPK"
536-631 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV"
1-718 DISORDER predicted by DISOPRED (1-1,162-163,165-166,460-492,639-656,661-663,665-665,672-677,681-712,714-715,717-718)

MONOMER
740
pdb_id a1 identity[%]2 description
4xw3 B 100.0 A3RJH1_HUMAN ATP-dependent RNA helicase DDX1
5e7j A 34.5 DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
5ivl A 38.1 A0A0K2H973_GEOSE DEAD-box ATP-dependent RNA helicase CshA
6qdv D 34.4 IF4A3_HUMAN Eukaryotic initiation factor 4A-III
2z0m A 35.8 Q96XQ7_SULTO 337aa long hypothetical ATP-dependent RNA helicase deaD
6b4i E 34.7 DD19B_HUMAN ATP-dependent RNA helicase DDX19B
6wou C 25.8 RYR2_MOUSE Ryanodine receptor 2
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
740 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6em1[2] LA CIC1_YEAST Proteasome-interacting protein CIC1[257 aa] NA 0.0
/44.3
1
/15
HAS1_YEAST ATP-dependent RNA helicase HAS1
5nt7[2] B OSKA_DROME Maternal effect protein oskar[92 aa] A 34.8
/40.2
23
/23
VASA1_DROME ATP-dependent RNA helicase vasa, isoform A
6f9s[2] B Q9XW17_CAEEL Cytokinesis, Apoptosis, RNA-associated[43 aa] A 33.3
/39.6
3
/3
DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6
6f9s[2] B Q9XW17_CAEEL Cytokinesis, Apoptosis, RNA-associated[43 aa] A 25.0
/39.6
8
/28
DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6
6yvh[4] E CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog[272 aa] H 42.9
/39.8
7
/21
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
4c9b[1] B CWC22_HUMAN PRE-MRNA-SPLICING FACTOR CWC22 HOMOLOG[277 aa] A 44.1
/34.0
34
/39
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
6yvh[1] E CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog[272 aa] F 50.0
/40.6
12
/12
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
2way[5] D EDC3_HUMAN ENHANCER OF MRNA-DECAPPING PROTEIN 3[30 aa] C 0.0
/37.0
1
/21
DDX6_HUMAN ATP-DEPENDENT RNA HELICASE DDX6
2yjt[1] A D8AM26_ECOLX REGULATOR OF RIBONUCLEASE ACTIVITY A[158 aa] D 50.0
/38.1
14
/17
SRMB_ECOLI ATP-DEPENDENT RNA HELICASE SRMB
4crw[1] A CNOT1_HUMAN CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1[226 aa] B 30.0
/39.6
10
/14
DDX6_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX6
5anr[2] A CNOT1_HUMAN CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1[245 aa] B 50.0
/35.7
14
/17
DDX6_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX6
4ct4[2] C CNOT1_HUMAN CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1[242 aa] D 32.1
/35.9
28
/28
DDX6_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX6
3eiq[2] B PDCD4_MOUSE Programmed cell death protein 4[278 aa] A 40.6
/32.7
32
/32
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
2zu6[4] B PDCD4_HUMAN Programmed cell death protein 4[284 aa] A 42.1
/33.5
38
/38
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
4brw[1] B PAT1_YEAST DNA TOPOISOMERASE 2-ASSOCIATED PROTEIN PAT1[30 aa].. A 12.5
/35.8
24
/24
DHH1_YEAST ATP-DEPENDENT RNA HELICASE DHH1
3peu[2] B GLE1_YEAST Nucleoporin GLE1[295 aa] A 40.0
/46.0
10
/14
DBP5_YEAST ATP-dependent RNA helicase DBP5
3rrm[2] B GLE1_YEAST Nucleoporin GLE1[295 aa] A 33.3
/34.5
21
/27
DBP5_YEAST ATP-dependent RNA helicase DBP5
3peu[2] B GLE1_YEAST Nucleoporin GLE1[295 aa] A 36.4
/46.0
11
/24
DBP5_YEAST ATP-dependent RNA helicase DBP5
5anr[2] C 4ET_HUMAN EUKARYOTIC TRANSLATION INITIATION FACTOR 4E TRANSP.. B 23.8
/35.7
21
/24
DDX6_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX6
4bru[1] B EDC3_YEAST ENHANCER OF MRNA-DECAPPING PROTEIN 3[29 aa] A 23.5
/35.6
17
/20
DHH1_YEAST ATP-DEPENDENT RNA HELICASE DHH1
6qx9[1] QA RUXG_HUMAN Small nuclear ribonucleoprotein G[73 aa] AA 0.0
/35.3
2
/2
DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23
6qx9[2] WA PRP8_HUMAN Pre-mRNA-processing-splicing factor 8[2212 aa] AA 50.0
/35.3
6
/65
DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23
6qdv[1] G PRP8_HUMAN Pre-mRNA-processing-splicing factor 8[2250 aa] D 0.0
/34.4
1
/1
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
2vso[4] C IF4F1_YEAST EUKARYOTIC INITIATION FACTOR 4F SUBUNIT P150[239 a.. A 35.0
/35.1
20
/30
IF4A_YEAST ATP-DEPENDENT RNA HELICASE EIF4A
2vsx[2] C IF4F1_YEAST EUKARYOTIC INITIATION FACTOR 4F SUBUNIT P150[240 a.. B 0.0
/35.1
3
/3
IF4A_YEAST ATP-DEPENDENT RNA HELICASE EIF4A
6s8r[1] B GGYF1_DROME GIGYF family protein CG11148[27 aa] A 11.1
/34.9
9
/21
DDX6_DROME ATP-dependent RNA helicase me31b
2j0u[1] C CASC3_HUMAN PROTEIN CASC3[9 aa] A 27.3
/34.8
11
/11
DDX48_HUMAN ATP-DEPENDENT RNA HELICASE DDX48
6b4i[4] A GLE1_HUMAN Nucleoporin GLE1[315 aa] F 23.8
/34.7
21
/26
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
3rrm[1] C NU159_YEAST Nucleoporin NUP159[370 aa] A 47.6
/34.5
21
/21
DBP5_YEAST ATP-dependent RNA helicase DBP5
2j0s[9] E CASC3_HUMAN PROTEIN CASC3[44 aa] A 25.0
/34.4
36
/37
DDX48_HUMAN ATP-DEPENDENT RNA HELICASE DDX48
2j0s[3] C RBM8A_HUMAN RNA-BINDING PROTEIN 8A[89 aa] A 0.0
/34.4
3
/3
DDX48_HUMAN ATP-DEPENDENT RNA HELICASE DDX48
3ex7[8] F RBM8A_HUMAN RNA-binding protein 8A[91 aa] G 0.0
/34.4
2
/2
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
6qdv[1] E RBM8A_HUMAN RNA-binding protein 8A[91 aa] D 0.0
/34.4
1
/1
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
2xb2[11] B MGN_HUMAN PROTEIN MAGO NASHI HOMOLOG[143 aa] A 6.5
/34.4
31
/34
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
6qdv[1] F MGN2_HUMAN Protein mago nashi homolog 2[144 aa] D 9.7
/34.4
31
/33
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
6icz[1] A MGN2_HUMAN Protein mago nashi homolog 2[144 aa] C 0.0
/34.4
4
/5
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
2xb2[1] F REN3B_HUMAN REGULATOR OF NONSENSE TRANSCRIPTS 3B[15 aa] A 57.1
/34.4
7
/11
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
5yzg[3] IA CASC3_HUMAN Protein CASC3[25 aa] FA 22.2
/34.4
18
/18
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
5yzg[2] W CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog[452 aa] FA 28.6
/34.4
7
/7
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
6qdv[1] N CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog[459 aa] D 30.0
/34.4
10
/11
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
6icz[1] V CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog[452 aa] C 100.0
/34.4
1
/1
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
6qdv[3] I U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein compone.. D 0.0
/34.4
6
/9
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
2xb2[1] J REN3B_HUMAN REGULATOR OF NONSENSE TRANSCRIPTS 3B[17 aa] K 50.0
/34.4
6
/9
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
5jiu[2] C DDX4_MOUSE Probable ATP-dependent RNA helicase DDX4[6 aa] A 0.0
/34.2
8
/11
RANB9_HUMAN Ran-binding protein 9
5suq[1] F Tho2, Hpr1, Mft1, and Thp2[2230 aa] C 25.0
/32.0
16
/16
SUB2_YEAST ATP-dependent RNA helicase SUB2
5suq[1] F Tho2, Hpr1, Mft1, and Thp2[2230 aa] A 0.0
/32.0
1
/1
SUB2_YEAST ATP-dependent RNA helicase SUB2
5suq[1] E Tho2, Hpr1, Mft1, and Thp2[2231 aa] A 15.4
/32.0
13
/13
SUB2_YEAST ATP-dependent RNA helicase SUB2
5suq[1] E Tho2, Hpr1, Mft1, and Thp2[2231 aa] C 0.0
/32.0
1
/1
SUB2_YEAST ATP-dependent RNA helicase SUB2
5sup[2] E YRA1_YEAST RNA annealing protein YRA1[17 aa] A 23.1
/31.8
13
/13
SUB2_YEAST ATP-dependent RNA helicase SUB2
5sup[1] F YRA1_YEAST RNA annealing protein YRA1[15 aa] C 23.1
/31.8
13
/13
SUB2_YEAST ATP-dependent RNA helicase SUB2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
740 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6elz[1] A 25S ribosomal RNA HA 0.0
/44.3
1
/5
HAS1_YEAST ATP-dependent RNA helicase HAS1
4db2[3] F 5'-R(*GP*GP*GP*CP*GP*GP*GP*CP*CP*CP*GP*CP*CP*C)-3'.. C 0.0
/38.7
1
/6
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
4db2[4] J 5'-R(*GP*GP*GP*CP*GP*GP*GP*CP*CP*CP*GP*CP*CP*C)-3'.. B 87.5
/38.7
8
/14
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
6uv3[1] B 125a-oligo2 A 72.0
/38.0
25
/25
DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17
6uv2[1] B RNA 125a_oligo1 A 72.0
/38.0
25
/25
DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17
6uv4[1] B 18a_oligo1 A 68.0
/38.0
25
/25
DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17
6uv1[2] C RNA rU10 A 73.9
/38.0
23
/23
DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17
2db3[3] C 5'-R(*UP*UP*UP*UP*UP*UP*UP*UP*UP*U)-3' G 76.2
/33.8
21
/21
VASA_DROME ATP-dependent RNA helicase vasa
4d26[2] B 5'-R(*UP*GP*AP*CP*AP*UP)-3' A 76.2
/36.5
21
/22
O01378_BOMMO BMVLG PROTEIN
3sqw[2] B RNA (5'-R(P*UP*UP*UP*UP*UP*UP*UP*UP*UP*U)-3') A 80.0
/36.0
20
/26
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
4tyn[1] A DNA (5'-D(P*AP*AP*AP*AP*AP*AP*A)-3') B 73.9
/36.0
23
/29
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
3i61[3] B 5'-R(*UP*UP*UP*UP*UP*UP*UP*UP*UP*U)-3' A 77.3
/36.0
22
/35
MS116_YEAST ATP-dependent RNA helicase MSS116
4tz6[3] B RNA (5'-R(P*AP*AP*AP*AP*AP*AP*A)-3') A 75.0
/36.0
20
/25
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
4tyy[1] A RNA (5'-R(P*AP*AP*AP*AP*AP*AP*AP*AP*A)-3') B 78.9
/36.0
19
/26
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
3i5y[1] B 5'-R(*UP*UP*UP*(5BU)P*UP*UP*UP*UP*UP*U)-3' A 73.9
/36.0
23
/35
MS116_YEAST ATP-dependent RNA helicase MSS116
3fht[2] C RNA (5'-R(*UP*UP*UP*UP*UP*UP*UP*UP*UP*U)-3') A 41.7
/35.0
24
/25
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
6qx9[1] A U1 snRNA AA 64.7
/35.3
17
/17
DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23
6qx9[1] H AdML pre-mRNA AA 0.0
/35.3
2
/2
DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23
3pey[2] B RNA (5'-R(P*UP*UP*UP*UP*UP*U)-3') A 66.7
/34.7
24
/25
DBP5_YEAST ATP-dependent RNA helicase DBP5
2hyi[4] B 5'-R(*UP*UP*UP*UP*UP*U)-3' I 73.9
/34.4
23
/23
DDX48_HUMAN Probable ATP-dependent RNA helicase DDX48
5elx[1] B RNA (5'-R(P*UP*UP*UP*UP*UP*U)-3') A 69.6
/34.7
23
/23
DBP5_YEAS7 ATP-dependent RNA helicase DBP5
3g0h[1] B 5'-R(P*UP*UP*UP*UP*UP*UP*U)-3' A 44.0
/35.0
25
/26
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
6o5f[1] C RNA (5'-R(P*CP*AP*AP*GP*GP*UP*CP*AP*UP*UP*CP*GP*CP.. A 61.5
/34.4
13
/15
DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
6o5f[1] C RNA (5'-R(P*CP*AP*AP*GP*GP*UP*CP*AP*UP*UP*CP*GP*CP.. B 0.0
/34.4
4
/5
DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
6o5f[1] D RNA (5'-R(P*CP*AP*AP*GP*GP*UP*CP*AP*UP*UP*CP*GP*CP.. B 61.5
/34.4
13
/16
DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
6o5f[1] D RNA (5'-R(P*CP*AP*AP*GP*GP*UP*CP*AP*UP*UP*CP*GP*CP.. A 0.0
/34.4
4
/5
DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
5yzg[1] G Pre-mRNA FA 66.7
/34.4
27
/27
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
2xb2[1] D RNA POLY-U-RIBONUCLEOTIDE A 66.7
/34.4
27
/27
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
6l5n[2] C poly(U)-15mer A 69.6
/34.0
23
/23
DDX21_HUMAN Nucleolar RNA helicase 2
2xb2[1] G RNA POLY-U-RIBONUCLEOTIDE K 78.3
/34.4
23
/23
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
5xjc[1] G pre-mRNA UA 66.7
/34.4
27
/27
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
5zc9[1] B RNA (5'-R(*AP*GP*AP*GP*AP*GP*AP*GP*AP*G)-3') A 61.5
/33.9
26
/26
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
2db3[1] D 5'-R(*UP*UP*UP*UP*UP*UP*UP*UP*UP*U)-3' H 76.2
/33.8
21
/21
VASA_DROME ATP-dependent RNA helicase vasa
5sup[3] G RNA (5'-R(P*UP*UP*UP*UP*UP*U)-3') A 59.1
/31.8
22
/22
SUB2_YEAST ATP-dependent RNA helicase SUB2
2j0q[3] H 5'-R(*UP*UP*UP*UP*UP*UP*UP*UP*UP*UP*UP*UP*UP*UP*U).. B 75.0
/34.4
24
/24
DDX48_HUMAN ATP-DEPENDENT RNA HELICASE DDX48
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
740 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2wax[2] K CXS
3-CYCLOHEXYL-1-PROPYLSULFONIC ACID[14 atoms]
C 25.0
/39.0
4
/7
DDX6_HUMAN ATP-DEPENDENT RNA HELICASE DDX6
6s8s[4] Q CXS
3-CYCLOHEXYL-1-PROPYLSULFONIC ACID[14 atoms]
C 33.3
/38.5
3
/8
DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6
5gvr[1] B LMR
(2S)-2-hydroxybutanedioic acid[9 atoms]
A 100.0
/38.9
1
/8
DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41
3iuy[2] E AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
B 57.1
/38.8
14
/14
DDX53_HUMAN Probable ATP-dependent RNA helicase DDX53
6aic[3] B AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 69.2
/37.1
13
/13
CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA
2i4i[1] B AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 0.0
/35.1
1
/14
DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
3ber[1] C AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 85.7
/39.2
14
/14
DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47
5e7j[1] B AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 83.3
/34.5
12
/12
DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
3nbf[1] I 8OP
[(2R,3S,4R,5R)-5-(6-azanyl-8-oxo-7H-purin-9-yl)-3,..
C 0.0
/37.6
5
/5
Q72GF3_THET2 Heat resistant RNA dependent ATPase
3nbf[3] J 8OP
[(2R,3S,4R,5R)-5-(6-azanyl-8-oxo-7H-purin-9-yl)-3,..
C 0.0
/37.6
1
/13
Q72GF3_THET2 Heat resistant RNA dependent ATPase
3mwl[1] F 8OX
6-azanyl-9-[(2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxy..
B 50.0
/37.6
2
/14
Q72GF3_THET2 Heat resistant RNA dependent ATPase
3nbf[4] H 8OD
[(2R,3S,4R,5R)-5-(6-azanyl-8-oxo-7H-purin-9-yl)-3,..
B 70.0
/37.6
10
/10
Q72GF3_THET2 Heat resistant RNA dependent ATPase
3nbf[2] G 8OD
[(2R,3S,4R,5R)-5-(6-azanyl-8-oxo-7H-purin-9-yl)-3,..
B 0.0
/37.6
1
/14
Q72GF3_THET2 Heat resistant RNA dependent ATPase
4tz0[1] C GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 50.0
/36.0
16
/16
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
4tz6[1] D UDP
URIDINE-5'-DIPHOSPHATE[25 atoms]
A 57.1
/36.0
14
/14
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
3fe2[8] D ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 71.4
/37.1
14
/14
DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5
3ews[10] D ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
B 66.7
/34.6
3
/17
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
6b4i[2] I ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
E 66.7
/34.7
3
/17
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
3i61[2] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 56.2
/36.0
16
/16
MS116_YEAST ATP-dependent RNA helicase MSS116
1xtj[8] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 50.0
/33.5
14
/14
UAP56_HUMAN Probable ATP-dependent RNA helicase p47
3dkp[1] D ADP
ADENOSINE-5'-DIPHOSPHATE[9 atoms]
A 66.7
/36.0
3
/4
DDX52_HUMAN Probable ATP-dependent RNA helicase DDX52
5dtu[1] B ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 66.7
/32.6
12
/12
G0SBQ7_CHATD Prp28
4tyy[1] D CDP
CYTIDINE-5'-DIPHOSPHATE[25 atoms]
B 60.0
/36.0
15
/15
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
3rrn[1] D IHP
INOSITOL HEXAKISPHOSPHATE[36 atoms]
A 0.0
/35.7
2
/4
DBP5_YEAST ATP-dependent RNA helicase DBP5
5zc9[1] C ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
A 53.3
/33.9
15
/20
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
3b7g[6] D ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
B 0.0
/34.3
1
/13
DDX20_HUMAN Probable ATP-dependent RNA helicase DDX20
2j0s[7] G ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
A 57.1
/34.4
21
/21
DDX48_HUMAN ATP-DEPENDENT RNA HELICASE DDX48
2db3[4] P ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
H 85.7
/33.8
7
/21
VASA_DROME ATP-dependent RNA helicase vasa
6b4k[6] H ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
B 80.0
/34.3
5
/20
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
3i5x[2] C ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
A 63.2
/36.0
19
/19
MS116_YEAST ATP-dependent RNA helicase MSS116
4w7s[1] I ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
B 58.3
/31.9
12
/12
PRP28_YEAST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28..
6l5n[1] H ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
B 25.0
/34.0
4
/5
DDX21_HUMAN Nucleolar RNA helicase 2
6l5n[2] G ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
B 100.0
/34.0
7
/21
DDX21_HUMAN Nucleolar RNA helicase 2
3g0h[1] C ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
A 81.8
/35.0
11
/17
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
5elx[1] C M2A
[(2~{R},3~{R},4~{R},5~{S})-2-(6-aminopurin-9-yl)-4..
A 55.6
/34.7
18
/18
DBP5_YEAS7 ATP-dependent RNA helicase DBP5
6qdv[1] JB ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms]
D 55.0
/34.4
20
/20
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
6cz5[1] B FPJ
5'-O-[(R)-hydroxy(propanoylamino)phosphoryl]adenos..
A 50.0
/34.2
8
/8
DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
5zc9[1] E RCG
(1R,2R,3S,3aR,8bS)-6,8-dimethoxy-3a-(4-methoxyphen..
A 40.0
/33.9
5
/5
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
5zbz[1] B SAU
13-methyl[1,3]benzodioxolo[5,6-c][1,3]dioxolo[4,5-..
A 50.0
/33.9
6
/6
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
5suq[2] G KEG
12-TUNGSTOPHOSPHATE[53 atoms]
A 50.0
/32.0
8
/8
SUB2_YEAST ATP-dependent RNA helicase SUB2
5suq[1] H KEG
12-TUNGSTOPHOSPHATE[53 atoms]
C 25.0
/32.0
4
/7
SUB2_YEAST ATP-dependent RNA helicase SUB2
5suq[1] H KEG
12-TUNGSTOPHOSPHATE[53 atoms]
A 33.3
/32.0
3
/3
SUB2_YEAST ATP-dependent RNA helicase SUB2
5suq[1] I KEG
12-TUNGSTOPHOSPHATE[53 atoms]
C 50.0
/32.0
6
/6
SUB2_YEAST ATP-dependent RNA helicase SUB2
5suq[1] I KEG
12-TUNGSTOPHOSPHATE[53 atoms]
A 100.0
/32.0
4
/4
SUB2_YEAST ATP-dependent RNA helicase SUB2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
740 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2rb4[1] F ZN
ZINC ION[1 atoms]
A 50.0
/41.7
2
/2
DDX25_HUMAN ATP-dependent RNA helicase DDX25
1fuk[1] B ZN
ZINC ION[1 atoms]
A 33.3
/42.6
3
/3
IF4A_YEAST EUKARYOTIC INITIATION FACTOR 4A
1vec[1] C ZN
ZINC ION[1 atoms]
B 0.0
/39.3
1
/1
DDX6_HUMAN ATP-dependent RNA helicase p54
1vec[1] C ZN
ZINC ION[1 atoms]
A 50.0
/39.3
2
/2
DDX6_HUMAN ATP-dependent RNA helicase p54
2gxs[2] G CA
CALCIUM ION[1 atoms]
B 50.0
/37.6
2
/2
O07897_THETH heat resistant RNA dependent ATPase
2gxs[2] H CA
CALCIUM ION[1 atoms]
B 75.0
/37.6
4
/4
O07897_THETH heat resistant RNA dependent ATPase
4kbf[1] E NA
SODIUM ION[1 atoms]
A 0.0
/37.3
2
/3
Q72GF3_THET2 Heat resistant RNA dependent ATPase
5xjc[11] UB MG
MAGNESIUM ION[1 atoms]
UA 100.0
/34.4
3
/3
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
3ly5[6] D MG
MAGNESIUM ION[1 atoms]
A 50.0
/34.7
2
/2
DDX18_HUMAN ATP-dependent RNA helicase DDX18
2pl3[1] B MG
MAGNESIUM ION[1 atoms]
A 100.0
/38.9
1
/1
DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10
3pey[2] F MG
MAGNESIUM ION[1 atoms]
A 0.0
/34.7
1
/1
DBP5_YEAST ATP-dependent RNA helicase DBP5
4ljy[7] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/32.3
3
/3
PRP5_YEAST Pre-mRNA-processing ATP-dependent RNA helicase PRP..
3pey[5] D MG
MAGNESIUM ION[1 atoms]
A 100.0
/34.7
3
/3
DBP5_YEAST ATP-dependent RNA helicase DBP5
4tyy[7] E MG
MAGNESIUM ION[1 atoms]
B 100.0
/36.0
3
/3
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
4d26[2] E MG
MAGNESIUM ION[1 atoms]
A 66.7
/36.5
3
/3
O01378_BOMMO BMVLG PROTEIN
6uv2[1] H MG
MAGNESIUM ION[1 atoms]
A 0.0
/38.0
3
/3
DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17
4ct4[3] F MG
MAGNESIUM ION[1 atoms]
B 50.0
/36.0
2
/2
DDX6_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX6
6b4k[4] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/35.1
1
/3
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
3ly5[1] E MG
MAGNESIUM ION[1 atoms]
A 75.0
/34.7
4
/6
DDX18_HUMAN ATP-dependent RNA helicase DDX18
6uv1[1] J MG
MAGNESIUM ION[1 atoms]
A 50.0
/38.0
2
/3
DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17
6uv2[2] G MG
MAGNESIUM ION[1 atoms]
A 60.0
/38.0
5
/6
DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17
6uv0[1] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/37.2
1
/1
DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17
6uv1[1] H MG
MAGNESIUM ION[1 atoms]
A 0.0
/38.0
2
/2
DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17
5sup[4] L MG
MAGNESIUM ION[1 atoms]
A 100.0
/31.8
2
/2
SUB2_YEAST ATP-dependent RNA helicase SUB2
6l5l[1] B MG
MAGNESIUM ION[1 atoms]
A 0.0
/34.9
1
/1
DDX21_HUMAN Nucleolar RNA helicase 2
5elx[1] D MG
MAGNESIUM ION[1 atoms]
A 100.0
/34.7
3
/3
DBP5_YEAS7 ATP-dependent RNA helicase DBP5
3pey[1] G MG
MAGNESIUM ION[1 atoms]
A 0.0
/34.7
1
/1
DBP5_YEAST ATP-dependent RNA helicase DBP5
5elx[1] H MG
MAGNESIUM ION[1 atoms]
A 0.0
/34.7
1
/1
DBP5_YEAS7 ATP-dependent RNA helicase DBP5
3i62[4] E MG
MAGNESIUM ION[1 atoms]
A 100.0
/36.0
2
/2
MS116_YEAST ATP-dependent RNA helicase MSS116
6l5n[1] J MG
MAGNESIUM ION[1 atoms]
B 0.0
/34.0
1
/1
DDX21_HUMAN Nucleolar RNA helicase 2
3fht[2] H MG
MAGNESIUM ION[1 atoms]
B 100.0
/35.7
2
/3
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
4ct4[1] H MG
MAGNESIUM ION[1 atoms]
D 25.0
/35.9
4
/4
DDX6_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX6
5dtu[1] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/32.6
4
/4
G0SBQ7_CHATD Prp28
6qdv[1] IB MG
MAGNESIUM ION[1 atoms]
D 100.0
/34.4
3
/3
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
5zc9[1] D MG
MAGNESIUM ION[1 atoms]
A 66.7
/33.9
3
/3
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
6uv1[1] P MG
MAGNESIUM ION[1 atoms]
B 25.0
/38.0
4
/4
DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17
4tyn[1] C MG
MAGNESIUM ION[1 atoms]
B 100.0
/36.0
5
/5
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
4tyw[1] D MG
MAGNESIUM ION[1 atoms]
A 42.9
/36.0
7
/7
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
6o5f[2] E CL
CHLORIDE ION[1 atoms]
A 100.0
/34.4
4
/4
DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
2rb4[1] D CL
CHLORIDE ION[1 atoms]
A 50.0
/41.7
2
/2
DDX25_HUMAN ATP-dependent RNA helicase DDX25
6o5f[2] H CL
CHLORIDE ION[1 atoms]
A 100.0
/34.4
5
/5
DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
6o5f[2] G CL
CHLORIDE ION[1 atoms]
A 33.3
/34.4
6
/7
DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
3eaq[1] D CL
CHLORIDE ION[1 atoms]
B 0.0
/41.9
1
/3
Q72GF3_THET2 Heat resistant RNA dependent ATPase
6o5f[2] F CL
CHLORIDE ION[1 atoms]
A 0.0
/34.4
3
/3
DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
4ct4[1] I CL
CHLORIDE ION[1 atoms]
D 60.0
/35.9
5
/5
DDX6_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX6
3eaq[1] C CL
CHLORIDE ION[1 atoms]
A 100.0
/42.5
3
/3
Q72GF3_THET2 Heat resistant RNA dependent ATPase
3iuy[1] F CL
CHLORIDE ION[1 atoms]
B 0.0
/38.8
1
/1
DDX53_HUMAN Probable ATP-dependent RNA helicase DDX53
3fe2[1] E CL
CHLORIDE ION[1 atoms]
B 0.0
/37.1
2
/3
DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5
4nho[1] J HG
MERCURY (II) ION[1 atoms]
A 16.7
/34.4
6
/6
DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23
4lk2[1] C NI
NICKEL (II) ION[1 atoms]
A 0.0
/32.2
1
/3
PRP5_YEAST Pre-mRNA-processing ATP-dependent RNA helicase PRP..
5vsn[1] C K
POTASSIUM ION[1 atoms]
A 0.0
/29.8
1
/2
RYR2_MOUSE Ryanodine receptor 2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
740 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4db4[2] E 5'-R(*GP*GP*GP*CP*GP*GP*G)-D(P*CP*CP*CP*GP*CP*CP*C.. A 50.0
/38.7
4
/4
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
4db4[2] C 5'-R(*GP*GP*GP*CP*GP*GP*G)-D(P*CP*CP*CP*GP*CP*CP*C.. A 100.0
/38.7
6
/11
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
740 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6f9s[2] A DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6[167 aa] A 17.6
/39.6
17
/17
DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6
1vec[1] A DDX6_HUMAN ATP-dependent RNA helicase p54[206 aa] B 25.0
/39.3
8
/8
DDX6_HUMAN ATP-dependent RNA helicase p54
1vec[1] B DDX6_HUMAN ATP-dependent RNA helicase p54[206 aa] A 14.3
/39.3
7
/8
DDX6_HUMAN ATP-dependent RNA helicase p54
2zu6[1] D IF4A1_HUMAN Eukaryotic initiation factor 4A-I[345 aa] F 0.0
/39.0
1
/1
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
2gxs[17] B O07897_THETH heat resistant RNA dependent ATPase[207 aa] A 25.0
/37.6
8
/18
O07897_THETH heat resistant RNA dependent ATPase
4kbf[3] A Q72GF3_THET2 Heat resistant RNA dependent ATPase[365 aa] B 20.0
/37.3
10
/20
Q72GF3_THET2 Heat resistant RNA dependent ATPase
1wrb[2] A O97032_DUGJA DjVLGB[232 aa] B 40.0
/37.2
25
/36
O97032_DUGJA DjVLGB
1hv8[2] B H669_METJA PUTATIVE ATP-DEPENDENT RNA HELICASE MJ0669[363 aa].. A 0.0
/36.2
10
/10
H669_METJA PUTATIVE ATP-DEPENDENT RNA HELICASE MJ0669
3fho[2] A DBP5_SCHPO ATP-dependent RNA helicase dbp5[305 aa] B 50.0
/32.2
2
/16
DBP5_SCHPO ATP-dependent RNA helicase dbp5
2vsx[2] B IF4A_YEAST ATP-DEPENDENT RNA HELICASE EIF4A[366 aa] A 36.4
/35.1
22
/22
IF4A_YEAST ATP-DEPENDENT RNA HELICASE EIF4A
1t6n[2] B UAP56_HUMAN Probable ATP-dependent RNA helicase[207 aa] A 33.3
/35.1
15
/16
UAP56_HUMAN Probable ATP-dependent RNA helicase
1fuu[1] A IF4A_YEAST YEAST INITIATION FACTOR 4A[215 aa] B 60.0
/34.7
5
/5
IF4A_YEAST YEAST INITIATION FACTOR 4A
6o5f[2] B DDX3X_HUMAN ATP-dependent RNA helicase DDX3X[417 aa] A 0.0
/34.4
4
/7
DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
5jiu[2] A RANB9_HUMAN Ran-binding protein 9[209 aa] B 66.7
/34.2
3
/10
RANB9_HUMAN Ran-binding protein 9
2zu6[1] F IF4A1_HUMAN Eukaryotic initiation factor 4A-I[271 aa] D 100.0
/33.9
1
/1
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
5suq[2] C SUB2_YEAST ATP-dependent RNA helicase SUB2[374 aa] A 36.4
/32.0
11
/12
SUB2_YEAST ATP-dependent RNA helicase SUB2
4w7s[2] A PRP28_YEAST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28.. B 25.0
/31.9
20
/20
PRP28_YEAST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28..
4p9l[4] A RYR2_MOUSE Ryanodine receptor 2[164 aa] A 66.7
/29.9
3
/19
RYR2_MOUSE Ryanodine receptor 2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
740 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1vec[2] D TLA
L(+)-TARTARIC ACID[10 atoms]
B 83.3
/39.3
6
/6
DDX6_HUMAN ATP-dependent RNA helicase p54
3ber[1] E PGE
TRIETHYLENE GLYCOL[10 atoms]
A 33.3
/39.2
3
/8
DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47
3ber[1] D PGE
TRIETHYLENE GLYCOL[10 atoms]
A 42.9
/39.2
7
/7
DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47
2pl3[1] D EOH
ETHANOL[3 atoms]
A 66.7
/38.9
3
/3
DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10
2pl3[1] E EOH
ETHANOL[3 atoms]
A 0.0
/38.9
1
/1
DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10
2pl3[1] G EOH
ETHANOL[3 atoms]
A 50.0
/38.9
6
/6
DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10
1wrb[3] D SO4
SULFATE ION[5 atoms]
B 85.7
/37.2
7
/7
O97032_DUGJA DjVLGB
1wrb[12] D SO4
SULFATE ION[5 atoms]
A 100.0
/37.2
1
/1
O97032_DUGJA DjVLGB
1hv8[2] F SO4
SULFATE ION[5 atoms]
A 33.3
/36.2
3
/3
H669_METJA PUTATIVE ATP-DEPENDENT RNA HELICASE MJ0669
6f9s[2] D SO4
SULFATE ION[5 atoms]
A 25.0
/39.6
4
/4
DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6
2rb4[2] G SO4
SULFATE ION[5 atoms]
B 0.0
/42.2
2
/2
DDX25_HUMAN ATP-dependent RNA helicase DDX25
1hv8[2] H SO4
SULFATE ION[5 atoms]
B 100.0
/36.2
6
/6
H669_METJA PUTATIVE ATP-DEPENDENT RNA HELICASE MJ0669
3mwk[11] C SO4
SULFATE ION[5 atoms]
A 85.7
/37.6
7
/7
Q72GF3_THET2 Heat resistant RNA dependent ATPase
1hv8[2] E SO4
SULFATE ION[5 atoms]
A 50.0
/36.2
4
/5
H669_METJA PUTATIVE ATP-DEPENDENT RNA HELICASE MJ0669
1hv8[2] E SO4
SULFATE ION[5 atoms]
B 0.0
/36.2
1
/1
H669_METJA PUTATIVE ATP-DEPENDENT RNA HELICASE MJ0669
4kbg[2] D SO4
SULFATE ION[5 atoms]
A 0.0
/37.6
7
/7
Q72GF3_THET2 Heat resistant RNA dependent ATPase
3mwk[3] D SO4
SULFATE ION[5 atoms]
A 0.0
/37.6
2
/2
Q72GF3_THET2 Heat resistant RNA dependent ATPase
1hv8[1] D SO4
SULFATE ION[5 atoms]
A 0.0
/36.2
3
/3
H669_METJA PUTATIVE ATP-DEPENDENT RNA HELICASE MJ0669
3fe2[2] C SO4
SULFATE ION[5 atoms]
A 83.3
/37.1
6
/6
DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5
4nho[1] F SO4
SULFATE ION[5 atoms]
A 100.0
/34.4
2
/3
DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23
3fe2[1] G SO4
SULFATE ION[5 atoms]
B 0.0
/37.1
3
/3
DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5
3i62[1] D ALF
TETRAFLUOROALUMINATE ION[5 atoms]
A 100.0
/36.0
8
/8
MS116_YEAST ATP-dependent RNA helicase MSS116
4brw[1] D 1PE
PENTAETHYLENE GLYCOL[16 atoms]
A 40.0
/35.8
5
/9
DHH1_YEAST ATP-DEPENDENT RNA HELICASE DHH1
4brw[1] C MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 0.0
/35.8
3
/5
DHH1_YEAST ATP-DEPENDENT RNA HELICASE DHH1
1t6n[2] D FLC
CITRATE ANION[13 atoms]
B 44.4
/35.1
9
/9
UAP56_HUMAN Probable ATP-dependent RNA helicase
5sup[3] N BEF
BERYLLIUM TRIFLUORIDE ION[4 atoms]
B 85.7
/31.8
7
/7
SUB2_YEAST ATP-dependent RNA helicase SUB2
6uv1[5] F BEF
BERYLLIUM TRIFLUORIDE ION[4 atoms]
A 100.0
/38.0
8
/8
DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17
4tyn[4] D BEF
BERYLLIUM TRIFLUORIDE ION[4 atoms]
B 100.0
/36.0
5
/5
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
5elx[1] E BEF
BERYLLIUM TRIFLUORIDE ION[4 atoms]
A 87.5
/34.7
8
/8
DBP5_YEAS7 ATP-dependent RNA helicase DBP5
3pey[2] E BEF
BERYLLIUM TRIFLUORIDE ION[4 atoms]
A 87.5
/34.7
8
/8
DBP5_YEAST ATP-dependent RNA helicase DBP5
3i61[1] D BEF
BERYLLIUM TRIFLUORIDE ION[4 atoms]
A 100.0
/36.0
7
/7
MS116_YEAST ATP-dependent RNA helicase MSS116
4tyw[1] E BEF
BERYLLIUM TRIFLUORIDE ION[4 atoms]
A 100.0
/36.0
8
/8
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial
6s8r[1] E ACT
ACETATE ION[4 atoms]
A 0.0
/34.9
1
/3
DDX6_DROME ATP-dependent RNA helicase me31b
6s8r[1] C ACT
ACETATE ION[4 atoms]
A 50.0
/34.9
2
/2
DDX6_DROME ATP-dependent RNA helicase me31b
4ct5[2] D ACT
ACETATE ION[4 atoms]
B 20.0
/36.0
5
/5
DDX6_HUMAN DDX6
6s8r[1] F ACT
ACETATE ION[4 atoms]
A 50.0
/34.9
2
/3
DDX6_DROME ATP-dependent RNA helicase me31b
3pey[2] L NO3
NITRATE ION[4 atoms]
A 0.0
/34.7
1
/1
DBP5_YEAST ATP-dependent RNA helicase DBP5
3pey[2] J NO3
NITRATE ION[4 atoms]
A 33.3
/34.7
3
/3
DBP5_YEAST ATP-dependent RNA helicase DBP5
3pey[3] H NO3
NITRATE ION[4 atoms]
A 25.0
/34.7
4
/4
DBP5_YEAST ATP-dependent RNA helicase DBP5
5elx[1] G NO3
NITRATE ION[4 atoms]
A 25.0
/34.7
4
/4
DBP5_YEAS7 ATP-dependent RNA helicase DBP5
3pew[1] I NO3
NITRATE ION[4 atoms]
A 20.0
/35.0
5
/5
DBP5_YEAST ATP-dependent RNA helicase DBP5
3pey[1] I NO3
NITRATE ION[4 atoms]
A 0.0
/34.7
2
/2
DBP5_YEAST ATP-dependent RNA helicase DBP5
2gxs[1] J GOL
GLYCEROL[6 atoms]
B 80.0
/37.6
5
/5
O07897_THETH heat resistant RNA dependent ATPase
3peu[4] D GOL
GLYCEROL[6 atoms]
A 57.1
/46.0
7
/7
DBP5_YEAST ATP-dependent RNA helicase DBP5
3fht[2] F GOL
GLYCEROL[6 atoms]
A 14.3
/35.0
7
/9
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
5vsn[1] B GOL
GLYCEROL[6 atoms]
A 0.0
/29.8
3
/3
RYR2_MOUSE Ryanodine receptor 2
2way[2] H GOL
GLYCEROL[6 atoms]
C 25.0
/37.0
4
/5
DDX6_HUMAN ATP-DEPENDENT RNA HELICASE DDX6
4c9b[1] K GOL
GLYCEROL[6 atoms]
A 40.0
/34.0
5
/5
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
4c9b[1] I GOL
GLYCEROL[6 atoms]
A 0.0
/34.0
4
/4
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
4c9b[1] G GOL
GLYCEROL[6 atoms]
A 71.4
/34.0
7
/7
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
4c9b[1] F GOL
GLYCEROL[6 atoms]
A 0.0
/34.0
4
/4
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
4c9b[1] E GOL
GLYCEROL[6 atoms]
A 100.0
/34.0
1
/1
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
4crw[1] G GOL
GLYCEROL[6 atoms]
B 0.0
/39.6
5
/5
DDX6_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX6
3dkp[1] E GOL
GLYCEROL[6 atoms]
A 75.0
/36.0
4
/4
DDX52_HUMAN Probable ATP-dependent RNA helicase DDX52
4nho[1] H GOL
GLYCEROL[6 atoms]
A 0.0
/34.4
1
/4
DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23
4d25[1] E GOL
GLYCEROL[6 atoms]
A 33.3
/36.5
3
/3
O01378_BOMMO BMVLG PROTEIN
4crw[1] C GOL
GLYCEROL[6 atoms]
B 50.0
/39.6
2
/2
DDX6_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX6
3fht[1] J GOL
GLYCEROL[6 atoms]
B 50.0
/35.7
6
/6
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
4c9b[1] J GOL
GLYCEROL[6 atoms]
A 66.7
/34.0
6
/6
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
2way[1] E GOL
GLYCEROL[6 atoms]
A 0.0
/38.3
5
/5
DDX6_HUMAN ATP-DEPENDENT RNA HELICASE DDX6
4w7s[1] H GOL
GLYCEROL[6 atoms]
A 0.0
/32.0
2
/2
PRP28_YEAST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28..
4c9b[1] H GOL
GLYCEROL[6 atoms]
A 0.0
/34.0
3
/3
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
4c9b[1] D GOL
GLYCEROL[6 atoms]
A 0.0
/34.0
4
/4
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
3g0h[1] E GOL
GLYCEROL[6 atoms]
A 20.0
/35.0
5
/7
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
6l5o[1] D GOL
GLYCEROL[6 atoms]
A 50.0
/34.6
2
/5
DDX21_HUMAN Nucleolar RNA helicase 2
4crw[1] H GOL
GLYCEROL[6 atoms]
B 20.0
/39.6
5
/6
DDX6_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX6
4nho[1] G GOL
GLYCEROL[6 atoms]
A 33.3
/34.4
6
/6
DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23
6kim[1] E GOL
GLYCEROL[6 atoms]
A 25.0
/30.8
4
/6
I3VR32_PLUXY Ryanodine receptor
3fht[1] K GOL
GLYCEROL[6 atoms]
B 50.0
/35.7
2
/2
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
2way[1] F GOL
GLYCEROL[6 atoms]
A 0.0
/38.3
3
/6
DDX6_HUMAN ATP-DEPENDENT RNA HELICASE DDX6
3pey[1] K GOL
GLYCEROL[6 atoms]
A 0.0
/34.7
4
/4
DBP5_YEAST ATP-dependent RNA helicase DBP5
3ly5[2] F SCN
THIOCYANATE ION[3 atoms]
A 75.0
/34.7
4
/4
DDX18_HUMAN ATP-dependent RNA helicase DDX18
4pxa[1] G PO4
PHOSPHATE ION[5 atoms]
A 0.0
/34.7
3
/4
DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
6b4i[5] K PO4
PHOSPHATE ION[5 atoms]
E 60.0
/34.7
5
/5
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
6b4i[4] J PO4
PHOSPHATE ION[5 atoms]
E 75.0
/34.7
4
/5
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
6s8s[4] F PO4
PHOSPHATE ION[5 atoms]
A 0.0
/39.6
3
/3
DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6
4d26[1] D PO4
PHOSPHATE ION[5 atoms]
A 88.9
/36.5
9
/9
O01378_BOMMO BMVLG PROTEIN
6s8s[1] I PO4
PHOSPHATE ION[5 atoms]
A 33.3
/39.6
6
/6
DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6
4c9b[1] C PO4
PHOSPHATE ION[5 atoms]
A 66.7
/34.0
6
/6
IF4A3_HUMAN EUKARYOTIC INITIATION FACTOR 4A-III
6s8s[1] H PO4
PHOSPHATE ION[5 atoms]
A 0.0
/39.6
1
/3
DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6
4pxa[3] E PO4
PHOSPHATE ION[5 atoms]
A 100.0
/34.7
4
/4
DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
2wax[2] H PO4
PHOSPHATE ION[5 atoms]
A 50.0
/39.6
4
/4
DDX6_HUMAN ATP-DEPENDENT RNA HELICASE DDX6
6s8s[2] O PO4
PHOSPHATE ION[5 atoms]
C 0.0
/38.5
3
/3
DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6
3ex7[2] O AF3
ALUMINUM FLUORIDE[4 atoms]
G 87.5
/34.4
8
/8
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
1xtk[1] B BME
BETA-MERCAPTOETHANOL[4 atoms]
A 50.0
/34.1
2
/2
UAP56_HUMAN Probable ATP-dependent RNA helicase p47
6b4k[1] F MLI
MALONATE ION[7 atoms]
A 75.0
/35.1
4
/4
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
6b4k[2] I MLI
MALONATE ION[7 atoms]
B 42.9
/34.3
7
/7
DD19B_HUMAN ATP-dependent RNA helicase DDX19B
5zbz[1] C MLI
MALONATE ION[7 atoms]
A 57.1
/33.9
7
/7
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
2zu6[1] I ACY
ACETIC ACID[4 atoms]
A 0.0
/33.5
1
/1
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
1xtj[1] D ACY
ACETIC ACID[4 atoms]
A 33.3
/33.5
3
/4
UAP56_HUMAN Probable ATP-dependent RNA helicase p47
2zu6[1] K ACY
ACETIC ACID[4 atoms]
D 50.0
/33.9
2
/2
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
2zu6[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/33.5
3
/3
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
2zu6[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 60.0
/33.5
10
/10
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
2zu6[1] J EDO
1,2-ETHANEDIOL[4 atoms]
D 50.0
/33.9
4
/4
IF4A1_HUMAN Eukaryotic initiation factor 4A-I
1xti[1] E IPA
ISOPROPYL ALCOHOL[4 atoms]
A 75.0
/33.8
4
/4
UAP56_HUMAN Probable ATP-dependent RNA helicase p47
1xti[1] C IPA
ISOPROPYL ALCOHOL[4 atoms]
A 33.3
/33.8
3
/6
UAP56_HUMAN Probable ATP-dependent RNA helicase p47
1xti[1] D IPA
ISOPROPYL ALCOHOL[4 atoms]
A 66.7
/33.8
3
/3
UAP56_HUMAN Probable ATP-dependent RNA helicase p47
1xti[1] B IPA
ISOPROPYL ALCOHOL[4 atoms]
A 37.5
/33.8
8
/8
UAP56_HUMAN Probable ATP-dependent RNA helicase p47
5jia[8] T IMD
IMIDAZOLE[5 atoms]
G 0.0
/33.6
3
/4
RBP10_MOUSE Ran-binding protein 10
4ljy[1] E MRD
(4R)-2-METHYLPENTANE-2,4-DIOL[8 atoms]
A 0.0
/32.3
2
/3
PRP5_YEAST Pre-mRNA-processing ATP-dependent RNA helicase PRP..
4ljy[1] D MRD
(4R)-2-METHYLPENTANE-2,4-DIOL[8 atoms]
A 0.0
/32.3
2
/5
PRP5_YEAST Pre-mRNA-processing ATP-dependent RNA helicase PRP..
4w7s[2] L P6G
HEXAETHYLENE GLYCOL[13 atoms]
B 100.0
/31.9
1
/5
PRP28_YEAST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28..
4w7s[2] J P6G
HEXAETHYLENE GLYCOL[19 atoms]
B 0.0
/31.9
4
/6
PRP28_YEAST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28..
4w7s[1] G P6G
HEXAETHYLENE GLYCOL[10 atoms]
A 33.3
/32.0
3
/3
PRP28_YEAST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28..
4w7s[1] E P6G
HEXAETHYLENE GLYCOL[7 atoms]
A 40.0
/32.0
5
/5
PRP28_YEAST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28..
4w7s[1] G P6G
HEXAETHYLENE GLYCOL[10 atoms]
B 20.0
/31.9
5
/5
PRP28_YEAST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28..
4w7s[1] D P6G
HEXAETHYLENE GLYCOL[7 atoms]
A 0.0
/32.0
3
/4
PRP28_YEAST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.