[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
56901 805 156 Q9BYF1(ACE2_HUMAN) RecName: Full=Angiotensin-converting enzyme 2; EC=3.4.17.23 {ECO:0000269|PubMed:10924499, ECO:0000269|PubMed:11815627, ECO:0000269|PubMed:19021774};AltName: Full=Angiotensin-converting enzyme homolog {ECO:0000303|PubMed:10924499}; Short=ACEH {ECO:0000303|PubMed:10924499};AltName: Full=Angiotensin-converting enzyme-related carboxypeptidase {ECO:0000303|PubMed:10969042}; Short=ACE-related carboxypeptidase; EC=3.4.17.- {ECO:0000269|PubMed:10924499, ECO:0000269|PubMed:10969042, ECO:0000269|PubMed:11815627, ECO:0000269|PubMed:19021774, ECO:0000269|PubMed:27217402, ECO:0000269|PubMed:28293165};AltName: Full=Metalloprotease MPROT15 {ECO:0000303|Ref.6};Contains: RecName: Full=Processed angiotensin-converting enzyme 2 {ECO:0000303|PubMed:24227843};Flags: Precursor;
QUERYSEQ
MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNE
IMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
AWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTL
PFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNK
NSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVM
GVIVVGIVILIFTGIRDRKKKNKARSGENPYASIDISKGENNPGFQNTDDVQTSF
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q9BYF1(ACE2_HUMAN)]

805
region name description
1-17 SIGNAL
18-805 CHAIN /note="Angiotensin-converting enzyme 2" /id="PRO_0000028570"
18-708 CHAIN /note="Processed angiotensin-converting enzyme 2" /id="PRO_0000292268"
18-740 TOPO_DOM /note="Extracellular"
741-761 TRANSMEM /note="Helical"
762-805 TOPO_DOM /note="Cytoplasmic"
30-41 REGION /note="Interaction with SARS-CoV spike glycoprotein"
82-84 REGION /note="Interaction with SARS-CoV spike glycoprotein"
345-346 REGION /note="Substrate binding"
353-357 REGION /note="Interaction with SARS-CoV spike glycoprotein"
652-659 REGION /note="Essential for cleavage by ADAM17"
697-716 REGION /note="Essential for cleavage by TMPRSS11D and TMPRSS2"
375-375 ACT_SITE /note="Proton acceptor" ECO:0000305|PubMed:27217402"
505-505 ACT_SITE /note="Proton donor"
374-374 METAL /note="Zinc; catalytic"
378-378 METAL /note="Zinc; catalytic"
402-402 METAL /note="Zinc; catalytic"
169-169 BINDING /note="Chloride" ECO:0000305|PubMed:19021774"
273-273 BINDING /note="Substrate"
477-477 BINDING /note="Chloride" ECO:0000305|PubMed:19021774"
481-481 BINDING /note="Chloride" ECO:0000305|PubMed:19021774"
515-515 BINDING /note="Substrate"
1-805 DISORDER predicted by DISOPRED (1-21,769-805)

MONOMER
805
pdb_id a1 identity[%]2 description
6m18 D 100.0 ACE2_HUMAN Angiotensin-converting enzyme 2
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
805 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6vw1[2] C SPIKE_CVHSA SPIKE_SARS2 SPIKE_CVHSA SARS-CoV-2 chimeric RBD[193 aa] A 100.0
/100.0
21
/21
ACE2_HUMAN Angiotensin-converting enzyme 2
6m1d[6] A S6A19_HUMAN Sodium-dependent neutral amino acid transporter B(.. B 100.0
/100.0
17
/17
ACE2_HUMAN Angiotensin-converting enzyme 2
7a95[8] A SPIKE_SARS2 Spike glycoprotein[1069 aa] D 100.0
/100.0
18
/18
ACE2_HUMAN Angiotensin-converting enzyme 2
1r4l[2] B disordered segment of collectrin homology domain[6.. A 100.0
/100.0
2
/2
ACE2_HUMAN angiotensin I converting enzyme 2
3sck[16] C SPIKE_CVHSA Spike glycoprotein[173 aa] A 77.8
/98.3
18
/18
ACE2_PAGLA ACE2_HUMAN Angiotensin-converting enzyme 2 chimera
3kbh[4] D SPIKE_CVHNL Spike glycoprotein[110 aa] C 100.0
/100.0
20
/20
ACE2_HUMAN Angiotensin-converting enzyme 2
1r4l[2] E disordered segment of collectrin homology domain[1.. A 100.0
/100.0
1
/1
ACE2_HUMAN angiotensin I converting enzyme 2
6acj[4] C SPIKE_CVHSA Spike glycoprotein[1057 aa] D 100.0
/100.0
20
/20
ACE2_HUMAN Angiotensin-converting enzyme 2
1r4l[2] C disordered segment of collectrin homology domain[2.. A 100.0
/100.0
2
/2
ACE2_HUMAN angiotensin I converting enzyme 2
7a92[1] B SPIKE_SARS2 Spike glycoprotein[643 aa] A 100.0
/100.0
18
/18
ACE2_HUMAN Angiotensin-converting enzyme 2
6m17[2] F SPIKE_SARS2 SARS-coV-2 Receptor Binding Domain[183 aa] E 100.0
/100.0
16
/16
ACE2_HUMAN Angiotensin-converting enzyme 2
6lzg[2] B SPIKE_SARS2 Spike glycoprotein[195 aa] A 100.0
/100.0
20
/20
ACE2_HUMAN Angiotensin-converting enzyme 2
7a91[1] B SPIKE_SARS2 Spike glycoprotein[251 aa] A 100.0
/100.0
18
/18
ACE2_HUMAN Angiotensin-converting enzyme 2
7c8d[1] B SPIKE_SARS2 Spike protein S1[195 aa] A 77.8
/86.1
18
/18
ACE2_FELCA Angiotensin-converting enzyme 2
6qs1[1] D Bradykinin potentiating peptide b[5 aa] B 60.0
/43.6
20
/20
ACE_HUMAN Angiotensin-converting enzyme
5am8[4] H A4_HUMAN BETA-AMYLOID PROTEIN 42[3 aa] D 54.5
/43.5
11
/11
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4aph[1] B ANGT_HUMAN ANGIOTENSIN-2[8 aa] A 50.0
/43.6
22
/22
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4apj[1] B BNP_GLOBL BRADYKININ-POTENTIATING PEPTIDE B[11 aa] A 28.6
/43.6
28
/28
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6qs1[1] C Bradykinin potentiating peptide b[11 aa] A 51.4
/43.5
37
/38
ACE_HUMAN Angiotensin-converting enzyme
5amb[2] C A4_HUMAN AMYLOID BETA A4 PROTEIN[2 aa] A 54.5
/43.4
11
/11
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4asr[2] B KNG1_HUMA BRADYKININ[4 aa] A 53.3
/37.7
15
/15
ACE_DROME ANGIOTENSIN-CONVERTING ENZYME
4aa2[1] B BNP_GLOBL BRADYKININ-POTENTIATING PEPTIDE B[6 aa] A 57.1
/37.7
21
/21
ACE_DROME ANGIOTENSIN-CONVERTING ENZYME
4aa1[1] B ANGT_HUMAN ANGIOTENSIN-2[5 aa] A 50.0
/37.7
20
/20
ACE_DROME ANGIOTENSIN-CONVERTING ENZYME
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
805 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6m18[2] EA 3PH
1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE[48 atoms]
D 100.0
/100.0
1
/1
ACE2_HUMAN Angiotensin-converting enzyme 2
1r4l[1] J XX5
(S,S)-2-{1-CARBOXY-2-[3-(3,5-DICHLORO-BENZYL)-3H-I..
A 100.0
/100.0
16
/16
ACE2_HUMAN angiotensin I converting enzyme 2
3d0i[3] K NDG
2-acetamido-2-deoxy-alpha-D-glucopyranose[15 atoms..
B 100.0
/98.5
3
/3
ACE2_PAGLA ACE2_HUMAN Angiotensin-converting enzyme 2
3d0i[6] E NDG
2-acetamido-2-deoxy-alpha-D-glucopyranose[15 atoms..
A 100.0
/98.5
3
/3
ACE2_PAGLA ACE2_HUMAN Angiotensin-converting enzyme 2
3d0g[3] I NDG
2-acetamido-2-deoxy-alpha-D-glucopyranose[15 atoms..
B 100.0
/98.5
1
/1
ACE2_PAGLA ACE2_HUMAN Angiotensin-converting enzyme 2
4bzs[2] W 9X6
thiodiglycolic acid[9 atoms]
B 33.3
/44.1
6
/6
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6en5[1] GA PE3
3,6,9,12,15,18,21,24,27,30,33,36,39-TRIDECAOXAHENT..
A 40.0
/43.8
10
/10
ACE_HUMAN Angiotensin-converting enzyme
6en5[10] ZA BJ2
(2~{S})-1-[(2~{S})-2-[[(1~{S})-1-[(2~{S})-1-[(2~{S..
C 58.8
/43.7
17
/17
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] WA 2PE
NONAETHYLENE GLYCOL[28 atoms]
B 20.0
/43.7
5
/5
ACE_HUMAN Angiotensin-converting enzyme
2x90[1] E EAL
1-((2S)-2-{[(1S)-1-CARBOXY-3-PHENYLPROPYL]AMINO}PR..
A 50.0
/37.7
14
/14
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
1uze[1] F EAL
1-((2S)-2-{[(1S)-1-CARBOXY-3-PHENYLPROPYL]AMINO}PR..
A 53.3
/43.7
15
/15
ACET_HUMAN ANGIOTENSIN CONVERTING ENZYME
2iux[2] H NXA
N-CARBOXYALANINE[9 atoms]
A 62.5
/43.3
8
/8
ACET_HUMAN ANGIOTENSIN-CONVERTING ENZYME
1uzf[1] E MCO
1-(3-MERCAPTO-2-METHYL-PROPIONYL)-PYRROLIDINE-2-CA..
A 58.3
/43.7
12
/12
ACET_HUMAN ANGIOTENSIN CONVERTING ENZYME
5am9[2] JA GLU
GLUTAMIC ACID[9 atoms]
C 85.7
/43.6
7
/7
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6tt4[4] U FT8
Omapatrilat[27 atoms]
B 57.1
/43.3
14
/14
ACE_HUMAN Angiotensin-converting enzyme
6h5w[1] G FT8
Omapatrilat[27 atoms]
A 53.3
/43.2
15
/15
ACE_HUMAN Angiotensin-converting enzyme
6h5w[1] H FT8
Omapatrilat[27 atoms]
A 27.3
/43.2
11
/11
ACE_HUMAN Angiotensin-converting enzyme
6h5w[1] I FT8
Omapatrilat[27 atoms]
A 10.0
/43.2
10
/10
ACE_HUMAN Angiotensin-converting enzyme
5am9[2] KA VAL
VALINE[8 atoms]
C 37.5
/43.6
8
/8
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6en5[6] ZB XPE
3,6,9,12,15,18,21,24,27-NONAOXANONACOSANE-1,29-DIO..
D 37.5
/43.6
8
/8
ACE_HUMAN Angiotensin-converting enzyme
4ufa[6] W ASP
ASPARTIC ACID[9 atoms]
B 42.9
/43.4
7
/7
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4ufb[4] QA PRO
PROLINE[8 atoms]
D 50.0
/43.4
8
/8
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
2xyd[2] P 3ES
[(2S)-2-({3-[HYDROXYL(2-PHENYL-(1R)-1-{[(BENZYLOXY..
B 54.5
/43.4
22
/22
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4ca8[1] C 3ES
[(2S)-2-({3-[HYDROXYL(2-PHENYL-(1R)-1-{[(BENZYLOXY..
A 45.8
/37.7
24
/24
ACE_DROME ANGIOTENSIN-CONVERTING ENZYME
2xy9[1] I 3ES
[(2S)-2-({3-[HYDROXYL(2-PHENYL-(1R)-1-{[(BENZYLOXY..
A 45.5
/43.6
22
/22
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
2xy9[1] J 3ES
[(2S)-2-({3-[HYDROXYL(2-PHENYL-(1R)-1-{[(BENZYLOXY..
A 21.1
/43.6
19
/19
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4bzs[2] N K26
N-ACETYL-L-ILE-L-TYR-(R)-1-AMINO-2-(4-HYDROXYPHENY..
A 78.6
/44.1
14
/15
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
2xhm[1] C K26
N-ACETYL-L-ILE-L-TYR-(R)-1-AMINO-2-(4-HYDROXYPHENY..
A 63.2
/37.7
19
/19
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
4bzr[1] E K26
N-ACETYL-L-ILE-L-TYR-(R)-1-AMINO-2-(4-HYDROXYPHENY..
A 64.7
/43.6
17
/17
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6f9v[2] R D0Z
Sampatrilat[40 atoms]
B 50.0
/43.6
20
/20
ACE_HUMAN Angiotensin-converting enzyme
6f9t[1] E D0Z
Sampatrilat[40 atoms]
A 47.1
/43.2
17
/17
ACE_HUMAN Angiotensin-converting enzyme
6f9r[1] CA PE8
3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL[25 a..
B 37.5
/43.5
8
/8
ACE_HUMAN Angiotensin-converting enzyme
3kbh[6] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
G 100.0
/100.0
2
/2
ACE2_HUMAN Angiotensin-converting enzyme 2
2xhm[22] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 80.0
/37.7
5
/5
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
2xhm[18] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/37.7
2
/2
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
3kbh[9] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
E 100.0
/100.0
3
/3
ACE2_HUMAN Angiotensin-converting enzyme 2
7a92[2] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
ACE2_HUMAN Angiotensin-converting enzyme 2
1r42[4] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
angiotensin I converting enzyme 2
6f9v[8] W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 33.3
/43.6
3
/3
ACE_HUMAN Angiotensin-converting enzyme
7a92[4] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ACE2_HUMAN Angiotensin-converting enzyme 2
6m17[6] BA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
2
/2
ACE2_HUMAN Angiotensin-converting enzyme 2
1uzf[13] B NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 60.0
/43.7
5
/5
ACET_HUMAN ANGIOTENSIN CONVERTING ENZYME
6f9v[1] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 25.0
/43.6
4
/4
ACE_HUMAN Angiotensin-converting enzyme
7a92[2] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ACE2_HUMAN Angiotensin-converting enzyme 2
2c6f[1] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/44.3
4
/4
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME, SOMATIC ISOFORM
6vw1[2] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ACE2_HUMAN Angiotensin-converting enzyme 2
1r42[1] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
angiotensin I converting enzyme 2
2ajf[5] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
4
/4
ACE2_HUMAN Angiotensin-converting enzyme-Related Carboxypepti..
5am8[13] UA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 80.0
/43.5
5
/5
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6vw1[1] W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
3
/3
ACE2_HUMAN Angiotensin-converting enzyme 2
1o8a[1] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/43.7
1
/1
ACET_HUMAN ANGIOTENSIN CONVERTING ENZYME
3bkl[2] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[15 atoms]..
A 33.3
/43.1
6
/6
ACE_HUMAN Angiotensin-converting enzyme, somatic isoform
2c6f[5] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 20.0
/44.3
5
/5
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME, SOMATIC ISOFORM
1o8a[1] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/43.7
1
/1
ACET_HUMAN ANGIOTENSIN CONVERTING ENZYME
1o8a[1] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/43.7
1
/1
ACET_HUMAN ANGIOTENSIN CONVERTING ENZYME
7a92[2] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
ACE2_HUMAN Angiotensin-converting enzyme 2
5am9[2] Q GLN
GLUTAMINE[9 atoms]
A 85.7
/43.6
7
/7
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6tt1[4] V 1IU
[3-[[(2S)-1-azanyl-1-oxidanylidene-propan-2-yl]ami..
B 55.6
/43.8
18
/18
ACE_HUMAN Angiotensin-converting enzyme
5am9[6] R LYS
LYSINE[10 atoms]
A 33.3
/43.6
9
/9
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4ufa[2] M SAC
N-ACETYL-SERINE[9 atoms]
A 85.7
/43.4
7
/7
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
5ama[4] HA SER
SERINE[7 atoms]
C 42.9
/43.6
7
/7
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
3nxq[2] P RX4
N~2~-acetyl-N-{(1R)-1-[(S)-[(2S)-3-{[(2S)-1-amino-..
B 52.6
/43.4
19
/19
ACE_HUMAN Angiotensin-converting enzyme
2x97[1] C RX4
N~2~-acetyl-N-{(1R)-1-[(S)-[(2S)-3-{[(2S)-1-amino-..
A 50.0
/37.7
18
/18
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
5amc[2] J NIY
META-NITRO-TYROSINE[16 atoms]
A 25.0
/43.6
8
/8
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
3l3n[1] F LSW
N~2~-[(1S)-1-carboxy-3-phenylpropyl]-L-lysyl-L-try..
A 50.0
/43.4
20
/20
ACE_HUMAN Angiotensin-converting enzyme
4ca6[2] V 3EF
N-{(2S)-3-[(S)-[(1R)-1-{[(benzyloxy)carbonyl]amino..
B 48.0
/43.5
25
/25
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME N-DOMAIN
4ca7[1] F 3EF
N-{(2S)-3-[(S)-[(1R)-1-{[(benzyloxy)carbonyl]amino..
A 44.0
/37.7
25
/25
ACE_DROME ANGIOTENSIN-CONVERTING ENZYME
4ca5[1] J 3EF
N-{(2S)-3-[(S)-[(1R)-1-{[(benzyloxy)carbonyl]amino..
A 43.5
/43.3
23
/23
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6tt3[5] V BCN
BICINE[11 atoms]
A 66.7
/43.3
6
/7
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] AA BCN
BICINE[11 atoms]
A 0.0
/43.8
1
/1
ACE_HUMAN Angiotensin-converting enzyme
2x96[1] C RX3
N-({(1S,2R)-2-[(S)-[(1R)-1-{[(BENZYLOXY)CARBONYL]A..
A 45.5
/37.7
22
/22
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
2oc2[1] E RX3
N-({(1S,2R)-2-[(S)-[(1R)-1-{[(BENZYLOXY)CARBONYL]A..
A 52.6
/43.3
19
/19
ACE_HUMAN Angiotensin-converting enzyme, somatic isoform
4c2o[1] G MLA
MALONIC ACID[7 atoms]
A 66.7
/43.3
9
/9
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
3bkl[1] K KAW
N-{(5S)-4,4-dihydroxy-6-phenyl-5-[(phenylcarbonyl)..
A 52.6
/43.1
19
/19
ACE_HUMAN Angiotensin-converting enzyme, somatic isoform
3bkk[1] H KAF
N-{(5S)-4,4-dihydroxy-6-phenyl-5-[(phenylcarbonyl)..
A 52.6
/43.1
19
/19
ACE_HUMAN Angiotensin-converting enzyme, somatic isoform
6f9r[2] J D0W
Sampatrilat-Asp[38 atoms]
A 50.0
/43.4
18
/18
ACE_HUMAN Angiotensin-converting enzyme
6f9u[1] H D0W
Sampatrilat-Asp[38 atoms]
A 50.0
/43.1
18
/18
ACE_HUMAN Angiotensin-converting enzyme
6s1z[1] C KS8
fosinoprilat[30 atoms]
A 50.0
/39.6
16
/16
A0NFU8_ANOGA Angiotensin-converting enzyme
6s1y[1] H KSN
(2~{S})-2-[[(4~{S})-4-azanyl-5-oxidanyl-5-oxidanyl..
A 50.0
/39.3
14
/14
A0NFU8_ANOGA Angiotensin-converting enzyme
2x95[1] I X95
(S)-1-N2-(1-CARBOXY-3-PHENYLPROPYL)-L-LYSYL-L-TRYP..
A 44.4
/37.7
18
/18
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
5a2r[1] B MLT
D-MALATE[9 atoms]
A 50.0
/37.7
8
/8
ACE_DROME ANGIOTENSIN-CONVERTING ENZYME
2ydm[1] G SLC
SELENO-CAPTOPRIL[14 atoms]
A 58.3
/43.7
12
/12
ACE_HUMAN ANGIOTENSIN CONVERTING ENZYME
3zqz[1] F SLC
SELENO-CAPTOPRIL[14 atoms]
A 55.6
/37.7
9
/9
ACE_DROME ANGIOTENSIN-CONVERTING ENZYME
2x92[1] G X92
RAMIPRILAT[28 atoms]
A 50.0
/37.7
14
/14
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
2x93[1] H X93
TRANDOLAPRILAT[29 atoms]
A 41.2
/37.7
17
/17
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
2x94[1] G X94
PERINDOPRILAT[24 atoms]
A 53.8
/37.7
13
/13
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
2x8z[1] C X8Z
L-CAPTOPRIL[14 atoms]
A 58.3
/37.7
12
/12
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
4c2p[1] F X8Z
L-CAPTOPRIL[14 atoms]
A 58.3
/43.4
12
/12
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
1j37[2] F X8Z
L-CAPTOPRIL[14 atoms]
B 58.3
/37.6
12
/12
ACE_DROME angiotensin converting enzyme
1o86[1] D LPR
[N2-[(S)-1-CARBOXY-3-PHENYLPROPYL]-L-LYSYL-L-PROLI..
A 52.9
/43.7
17
/17
ACET_HUMAN ANGIOTENSIN CONVERTING ENZYME
2c6n[2] I LPR
[N2-[(S)-1-CARBOXY-3-PHENYLPROPYL]-L-LYSYL-L-PROLI..
A 50.0
/44.3
14
/14
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME, SOMATIC ISOFORM
1j36[2] D LPR
[N2-[(S)-1-CARBOXY-3-PHENYLPROPYL]-L-LYSYL-L-PROLI..
A 50.0
/37.6
16
/16
ACE_DROME angiotensin converting enzyme
2x91[1] C LPR
[N2-[(S)-1-CARBOXY-3-PHENYLPROPYL]-L-LYSYL-L-PROLI..
A 50.0
/37.7
16
/16
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
805 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7c8d[1] C ZN
ZINC ION[1 atoms]
A 100.0
/86.1
4
/4
ACE2_FELCA Angiotensin-converting enzyme 2
1j37[9] C ZN
ZINC ION[1 atoms]
A 100.0
/37.6
3
/3
ACE_DROME angiotensin converting enzyme
2ajf[20] J ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
ACE2_HUMAN Angiotensin-converting enzyme-Related Carboxypepti..
6m17[4] CA ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
ACE2_HUMAN Angiotensin-converting enzyme 2
6en5[58] OB ZN
ZINC ION[1 atoms]
D 100.0
/43.6
3
/3
ACE_HUMAN Angiotensin-converting enzyme
3l3n[40] C ZN
ZINC ION[1 atoms]
A 100.0
/43.4
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6s1z[2] D ZN
ZINC ION[1 atoms]
A 100.0
/39.6
4
/4
A0NFU8_ANOGA Angiotensin-converting enzyme
7a92[3] I ZN
ZINC ION[1 atoms]
A 100.0
/100.0
3
/3
ACE2_HUMAN Angiotensin-converting enzyme 2
2xy9[1] F ZN
ZINC ION[1 atoms]
A 100.0
/43.6
3
/3
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
5am9[2] NA CA
CALCIUM ION[1 atoms]
C 66.7
/43.6
3
/3
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
5am9[2] WA NA
SODIUM ION[1 atoms]
D 66.7
/43.4
3
/3
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6f9r[17] N MG
MAGNESIUM ION[1 atoms]
A 66.7
/43.4
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6qs1[56] IA CL
CHLORIDE ION[1 atoms]
B 50.0
/43.6
6
/6
ACE_HUMAN Angiotensin-converting enzyme
3scl[19] F CL
CHLORIDE ION[1 atoms]
A 100.0
/98.3
4
/4
ACE2_PAGLA ACE2_HUMAN Angiotensin-converting enzyme 2 chimera
1uzf[22] G CL
CHLORIDE ION[1 atoms]
A 50.0
/43.7
6
/6
ACET_HUMAN ANGIOTENSIN CONVERTING ENZYME
3bkk[23] F CL
CHLORIDE ION[1 atoms]
A 80.0
/43.1
5
/5
ACE_HUMAN Angiotensin-converting enzyme, somatic isoform
6qs1[4] JA CL
CHLORIDE ION[1 atoms]
B 50.0
/43.6
4
/4
ACE_HUMAN Angiotensin-converting enzyme
1r4l[2] H CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
ACE2_HUMAN angiotensin I converting enzyme 2
2xy9[1] E CL
CHLORIDE ION[1 atoms]
A 60.0
/43.6
5
/5
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
2xy9[1] D CL
CHLORIDE ION[1 atoms]
A 80.0
/43.6
5
/5
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
805 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6vw1[1] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-3)-bet.. B 100.0
/100.0
5
/5
ACE2_HUMAN Angiotensin-converting enzyme 2
6m18[4] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
3
/3
ACE2_HUMAN Angiotensin-converting enzyme 2
6h5x[42] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 66.7
/43.6
6
/6
ACE_HUMAN Angiotensin-converting enzyme
6m18[4] O 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/100.0
4
/4
ACE2_HUMAN Angiotensin-converting enzyme 2
6vw1[1] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
2
/2
ACE2_HUMAN Angiotensin-converting enzyme 2
6m18[4] Q 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/100.0
4
/4
ACE2_HUMAN Angiotensin-converting enzyme 2
6vw1[1] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
5
/5
ACE2_HUMAN Angiotensin-converting enzyme 2
6m18[4] R 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/100.0
4
/4
ACE2_HUMAN Angiotensin-converting enzyme 2
2c6f[2] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 40.0
/44.3
5
/5
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME, SOMATIC ISOFORM
6vw1[2] K 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
1
/1
ACE2_HUMAN Angiotensin-converting enzyme 2
7a92[2] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
3
/3
ACE2_HUMAN Angiotensin-converting enzyme 2
2c6f[2] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 33.3
/44.3
3
/3
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME, SOMATIC ISOFORM
6tt3[4] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 50.0
/43.3
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6m17[4] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
3
/3
ACE2_HUMAN Angiotensin-converting enzyme 2
6s1y[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/39.3
3
/3
A0NFU8_ANOGA Angiotensin-converting enzyme
6h5w[2] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 60.0
/43.2
5
/5
ACE_HUMAN Angiotensin-converting enzyme
6m17[4] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
2
/2
ACE2_HUMAN Angiotensin-converting enzyme 2
6en5[1] O alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. D 60.0
/43.6
5
/5
ACE_HUMAN Angiotensin-converting enzyme
5am9[2] G alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 50.0
/43.6
6
/6
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
5ama[2] L beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 60.0
/43.6
5
/5
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6en5[11] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. D 25.0
/43.6
4
/4
ACE_HUMAN Angiotensin-converting enzyme
3bkl[4] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 33.3
/43.1
6
/6
ACE_HUMAN Angiotensin-converting enzyme, somatic isoform
6h5x[2] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 50.0
/43.6
8
/8
ACE_HUMAN Angiotensin-converting enzyme
6s1z[3] B beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 60.0
/39.6
5
/5
A0NFU8_ANOGA Angiotensin-converting enzyme
4ufa[15] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 60.0
/43.4
5
/5
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4apj[5] C beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/43.6
1
/1
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6vw1[3] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
2
/2
ACE2_HUMAN Angiotensin-converting enzyme 2
6vw1[1] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
2
/2
ACE2_HUMAN Angiotensin-converting enzyme 2
5am9[1] E beta-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-beta.. A 60.0
/43.6
5
/5
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
5ama[2] N alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. D 50.0
/43.6
6
/6
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
5am9[23] P beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. D 60.0
/43.4
5
/5
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4c2o[5] B beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 42.9
/43.3
7
/7
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
2xy9[1] B beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 40.0
/43.6
5
/5
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6tt1[36] E alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. B 25.0
/43.8
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6tt4[1] F alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 60.0
/43.3
5
/5
ACE_HUMAN Angiotensin-converting enzyme
2iul[1] B beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1.. A 42.9
/43.2
7
/7
ACET_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6f9t[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-2)-alp.. A 36.4
/43.2
11
/11
ACE_HUMAN Angiotensin-converting enzyme
6f9v[1] C alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. A 50.0
/43.5
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6f9u[1] B alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. A 42.9
/43.1
7
/7
ACE_HUMAN Angiotensin-converting enzyme
2x92[18] B beta-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(.. A 0.0
/37.7
3
/3
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
805 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6m1d[6] B ACE2_HUMAN Angiotensin-converting enzyme 2[748 aa] D 100.0
/100.0
14
/14
ACE2_HUMAN Angiotensin-converting enzyme 2
3d0h[3] B ACE2_PAGLA ACE2_HUMAN Angiotensin-converting enzyme 2[597 aa] A 100.0
/98.5
2
/2
ACE2_PAGLA ACE2_HUMAN Angiotensin-converting enzyme 2
3kbh[4] E ACE2_HUMAN Angiotensin-converting enzyme 2[593 aa] A 100.0
/100.0
6
/6
ACE2_HUMAN Angiotensin-converting enzyme 2
3d0h[3] A ACE2_PAGLA ACE2_HUMAN Angiotensin-converting enzyme 2[597 aa] B 100.0
/98.5
3
/3
ACE2_PAGLA ACE2_HUMAN Angiotensin-converting enzyme 2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
805 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2c6n[3] K GOL
GLYCEROL[6 atoms]
A 33.3
/44.3
6
/6
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME, SOMATIC ISOFORM
3bkl[1] L GOL
GLYCEROL[6 atoms]
A 20.0
/43.1
5
/5
ACE_HUMAN Angiotensin-converting enzyme, somatic isoform
4c2p[1] H GOL
GLYCEROL[6 atoms]
A 66.7
/43.4
3
/3
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
2c6n[1] J GOL
GLYCEROL[6 atoms]
A 0.0
/44.3
1
/1
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME, SOMATIC ISOFORM
6en6[1] Z PGE
TRIETHYLENE GLYCOL[10 atoms]
A 22.2
/43.8
9
/9
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] IC PGE
TRIETHYLENE GLYCOL[10 atoms]
D 20.0
/43.7
5
/6
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] UA PGE
TRIETHYLENE GLYCOL[10 atoms]
B 12.5
/43.7
8
/8
ACE_HUMAN Angiotensin-converting enzyme
6tt1[2] DA PGE
TRIETHYLENE GLYCOL[10 atoms]
B 0.0
/43.8
1
/1
ACE_HUMAN Angiotensin-converting enzyme
6tt4[7] M PGE
TRIETHYLENE GLYCOL[10 atoms]
A 0.0
/43.4
2
/2
ACE_HUMAN Angiotensin-converting enzyme
6h5x[1] DA PGE
TRIETHYLENE GLYCOL[10 atoms]
B 12.5
/43.4
8
/8
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] JC PGE
TRIETHYLENE GLYCOL[10 atoms]
D 33.3
/43.7
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6f9t[1] Q PGE
TRIETHYLENE GLYCOL[10 atoms]
A 40.0
/43.2
5
/5
ACE_HUMAN Angiotensin-converting enzyme
6tt3[1] N PGE
TRIETHYLENE GLYCOL[10 atoms]
A 33.3
/43.3
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] VA PGE
TRIETHYLENE GLYCOL[10 atoms]
B 0.0
/43.7
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6tt4[1] W PGE
TRIETHYLENE GLYCOL[10 atoms]
B 25.0
/43.3
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6h5x[10] Y EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/43.4
2
/2
ACE_HUMAN Angiotensin-converting enzyme
6f9t[1] K EDO
1,2-ETHANEDIOL[4 atoms]
A 60.0
/43.2
5
/5
ACE_HUMAN Angiotensin-converting enzyme
6f9u[4] O EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/43.1
6
/6
ACE_HUMAN Angiotensin-converting enzyme
6en6[19] OA EDO
1,2-ETHANEDIOL[4 atoms]
B 33.3
/43.7
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6f9r[1] AA EDO
1,2-ETHANEDIOL[4 atoms]
B 40.0
/43.5
5
/5
ACE_HUMAN Angiotensin-converting enzyme
6h5x[5] Q EDO
1,2-ETHANEDIOL[4 atoms]
A 40.0
/43.6
5
/5
ACE_HUMAN Angiotensin-converting enzyme
6f9v[8] Y EDO
1,2-ETHANEDIOL[4 atoms]
B 50.0
/43.6
2
/2
ACE_HUMAN Angiotensin-converting enzyme
6vw1[5] P EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
ACE2_HUMAN Angiotensin-converting enzyme 2
6en5[11] CA EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/43.8
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6en5[1] GB EDO
1,2-ETHANEDIOL[4 atoms]
C 0.0
/43.7
1
/1
ACE_HUMAN Angiotensin-converting enzyme
6en5[2] JB EDO
1,2-ETHANEDIOL[4 atoms]
C 50.0
/43.7
2
/3
ACE_HUMAN Angiotensin-converting enzyme
6tt3[3] T EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/43.3
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] NA EDO
1,2-ETHANEDIOL[4 atoms]
B 0.0
/43.7
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6h5w[1] Q EDO
1,2-ETHANEDIOL[4 atoms]
A 80.0
/43.2
5
/5
ACE_HUMAN Angiotensin-converting enzyme
6en5[3] FB EDO
1,2-ETHANEDIOL[4 atoms]
C 50.0
/43.7
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] KA EDO
1,2-ETHANEDIOL[4 atoms]
B 50.0
/43.7
8
/8
ACE_HUMAN Angiotensin-converting enzyme
6f9r[1] BA EDO
1,2-ETHANEDIOL[4 atoms]
B 25.0
/43.5
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6tt4[1] AA EDO
1,2-ETHANEDIOL[4 atoms]
B 0.0
/43.3
2
/2
ACE_HUMAN Angiotensin-converting enzyme
6en5[1] IB EDO
1,2-ETHANEDIOL[4 atoms]
C 0.0
/43.7
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] HB EDO
1,2-ETHANEDIOL[4 atoms]
C 33.3
/43.7
3
/5
ACE_HUMAN Angiotensin-converting enzyme
6en6[5] V EDO
1,2-ETHANEDIOL[4 atoms]
A 60.0
/43.8
5
/5
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] IB EDO
1,2-ETHANEDIOL[4 atoms]
C 0.0
/43.7
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6en6[2] JA EDO
1,2-ETHANEDIOL[4 atoms]
B 66.7
/43.7
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6h5x[1] T EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/43.6
4
/6
ACE_HUMAN Angiotensin-converting enzyme
6en5[2] WB EDO
1,2-ETHANEDIOL[4 atoms]
D 33.3
/43.6
3
/4
ACE_HUMAN Angiotensin-converting enzyme
6h5w[1] R EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/43.2
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6h5w[1] P EDO
1,2-ETHANEDIOL[4 atoms]
A 37.5
/43.2
8
/8
ACE_HUMAN Angiotensin-converting enzyme
6en5[2] RA EDO
1,2-ETHANEDIOL[4 atoms]
B 33.3
/43.7
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6s1y[1] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/39.3
2
/2
A0NFU8_ANOGA Angiotensin-converting enzyme
6en6[1] W EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/43.8
1
/1
ACE_HUMAN Angiotensin-converting enzyme
6en5[2] BA EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/43.8
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] LA EDO
1,2-ETHANEDIOL[4 atoms]
B 0.0
/43.7
1
/1
ACE_HUMAN Angiotensin-converting enzyme
6vw1[1] T EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
9
/9
ACE2_HUMAN Angiotensin-converting enzyme 2
6f9v[2] M EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/43.5
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6f9u[2] Q EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/43.1
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6tt1[1] AA EDO
1,2-ETHANEDIOL[4 atoms]
B 16.7
/43.8
6
/6
ACE_HUMAN Angiotensin-converting enzyme
6tt3[1] FA EDO
1,2-ETHANEDIOL[4 atoms]
B 50.0
/43.3
8
/9
ACE_HUMAN Angiotensin-converting enzyme
6f9u[1] N EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/43.1
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6en5[1] Z EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/43.8
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] YB EDO
1,2-ETHANEDIOL[4 atoms]
D 60.0
/43.7
5
/5
ACE_HUMAN Angiotensin-converting enzyme
6f9u[1] L EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/43.1
2
/2
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] UB EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/43.7
1
/1
ACE_HUMAN Angiotensin-converting enzyme
6en5[2] TA EDO
1,2-ETHANEDIOL[4 atoms]
B 33.3
/43.7
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6tt3[1] S EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/43.3
6
/6
ACE_HUMAN Angiotensin-converting enzyme
6en5[1] UA EDO
1,2-ETHANEDIOL[4 atoms]
B 0.0
/43.7
2
/2
ACE_HUMAN Angiotensin-converting enzyme
5amc[2] I GLY
GLYCINE[4 atoms]
A 83.3
/43.6
6
/6
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
1uze[2] B GLY
GLYCINE[4 atoms]
A 16.7
/43.7
6
/6
ACET_HUMAN ANGIOTENSIN CONVERTING ENZYME
4apj[1] E SO4
SULFATE ION[5 atoms]
A 33.3
/43.6
3
/3
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
5am8[4] LA SO4
SULFATE ION[5 atoms]
C 25.0
/43.6
4
/4
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4c2r[4] E SO4
SULFATE ION[5 atoms]
A 85.7
/43.2
7
/7
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4ca8[1] G SO4
SULFATE ION[5 atoms]
A 40.0
/37.7
5
/5
ACE_DROME ANGIOTENSIN-CONVERTING ENZYME
4ca8[1] D SO4
SULFATE ION[5 atoms]
A 100.0
/37.7
1
/1
ACE_DROME ANGIOTENSIN-CONVERTING ENZYME
4ca8[1] F SO4
SULFATE ION[5 atoms]
A 25.0
/37.7
4
/4
ACE_DROME ANGIOTENSIN-CONVERTING ENZYME
6f9v[1] FA P33
3,6,9,12,15,18-HEXAOXAICOSANE-1,20-DIOL[22 atoms]
B 33.3
/43.6
6
/6
ACE_HUMAN Angiotensin-converting enzyme
4apj[1] J PE4
2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}..
A 44.4
/43.6
9
/10
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4apj[7] H PE4
2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}..
A 33.3
/43.6
9
/9
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4apj[1] I PE4
2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}..
A 25.0
/43.6
4
/4
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4bzs[1] K PE4
2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}..
A 50.0
/44.1
4
/4
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4ufb[40] GA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 66.7
/43.4
3
/3
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4bxk[7] I PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 50.0
/43.4
2
/2
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
5am9[30] OA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
C 0.0
/43.6
4
/4
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6f9t[2] P PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 80.0
/43.2
5
/5
ACE_HUMAN Angiotensin-converting enzyme
5ama[9] CA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 0.0
/43.4
1
/1
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
5am8[4] XA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
D 0.0
/43.5
1
/1
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6tt3[16] O PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 0.0
/43.3
1
/1
ACE_HUMAN Angiotensin-converting enzyme
6qs1[1] BA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 50.0
/43.6
4
/4
ACE_HUMAN Angiotensin-converting enzyme
5amb[4] P PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 12.5
/43.4
8
/8
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
2xyd[1] M PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 0.0
/43.4
2
/2
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6en5[4] MA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 80.0
/43.7
5
/5
ACE_HUMAN Angiotensin-converting enzyme
6en5[1] DB PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
C 60.0
/43.7
5
/5
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] EB PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
C 0.0
/43.7
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6f9u[1] R PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 40.0
/43.1
5
/5
ACE_HUMAN Angiotensin-converting enzyme
6qs1[1] CA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 50.0
/43.6
6
/6
ACE_HUMAN Angiotensin-converting enzyme
6en5[1] W PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 20.0
/43.8
5
/5
ACE_HUMAN Angiotensin-converting enzyme
6s1y[1] D PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 33.3
/39.3
3
/4
A0NFU8_ANOGA Angiotensin-converting enzyme
6f9t[1] O PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/43.2
5
/5
ACE_HUMAN Angiotensin-converting enzyme
4bzs[1] R PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 25.0
/44.1
4
/4
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
4ca5[1] I PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 60.0
/43.3
5
/5
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6f9t[1] N PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 20.0
/43.2
5
/5
ACE_HUMAN Angiotensin-converting enzyme
6en6[1] SB PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
D 33.3
/43.7
3
/3
ACE_HUMAN Angiotensin-converting enzyme
2xyd[4] S PG4
TETRAETHYLENE GLYCOL[13 atoms]
B 50.0
/43.4
4
/4
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6en5[10] NB PG4
TETRAETHYLENE GLYCOL[13 atoms]
C 0.0
/43.7
1
/1
ACE_HUMAN Angiotensin-converting enzyme
6en5[2] XA PG4
TETRAETHYLENE GLYCOL[13 atoms]
B 25.0
/43.7
8
/8
ACE_HUMAN Angiotensin-converting enzyme
5amb[11] Q P6G
HEXAETHYLENE GLYCOL[19 atoms]
A 70.0
/43.4
10
/11
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6h5w[1] N P6G
HEXAETHYLENE GLYCOL[19 atoms]
A 55.6
/43.2
9
/9
ACE_HUMAN Angiotensin-converting enzyme
3nxq[16] S P6G
HEXAETHYLENE GLYCOL[19 atoms]
B 25.0
/43.4
4
/4
ACE_HUMAN Angiotensin-converting enzyme
4ufb[6] UA P6G
HEXAETHYLENE GLYCOL[19 atoms]
D 25.0
/43.4
8
/8
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
2iux[5] D ACT
ACETATE ION[4 atoms]
A 83.3
/43.3
6
/6
ACET_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6f9r[1] P ACT
ACETATE ION[4 atoms]
A 0.0
/43.4
3
/3
ACE_HUMAN Angiotensin-converting enzyme
4c2r[3] F ACT
ACETATE ION[4 atoms]
A 42.9
/43.2
7
/7
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6en6[9] X ACT
ACETATE ION[4 atoms]
A 66.7
/43.8
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6en6[3] LB ACT
ACETATE ION[4 atoms]
C 0.0
/43.7
4
/4
ACE_HUMAN Angiotensin-converting enzyme
2c6f[2] M ACT
ACETATE ION[4 atoms]
A 40.0
/44.3
5
/5
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME, SOMATIC ISOFORM
6en6[2] KB ACT
ACETATE ION[4 atoms]
C 50.0
/43.7
2
/3
ACE_HUMAN Angiotensin-converting enzyme
4aph[3] M ACT
ACETATE ION[4 atoms]
A 75.0
/43.6
4
/4
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
3bkl[1] J ACT
ACETATE ION[4 atoms]
A 75.0
/43.1
4
/4
ACE_HUMAN Angiotensin-converting enzyme, somatic isoform
3bkl[1] H ACT
ACETATE ION[4 atoms]
A 11.1
/43.1
9
/9
ACE_HUMAN Angiotensin-converting enzyme, somatic isoform
4aph[2] L ACT
ACETATE ION[4 atoms]
A 40.0
/43.6
5
/5
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6en6[4] Y ACT
ACETATE ION[4 atoms]
A 50.0
/43.8
4
/4
ACE_HUMAN Angiotensin-converting enzyme
2c6f[1] L ACT
ACETATE ION[4 atoms]
A 0.0
/44.3
2
/2
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME, SOMATIC ISOFORM
4c2q[5] F ACT
ACETATE ION[4 atoms]
A 50.0
/43.1
6
/6
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
3bkl[1] I ACT
ACETATE ION[4 atoms]
A 66.7
/43.1
3
/3
ACE_HUMAN Angiotensin-converting enzyme, somatic isoform
2xy9[1] C ACT
ACETATE ION[4 atoms]
A 42.9
/43.6
7
/7
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
6qs1[9] DA BO3
BORIC ACID[4 atoms]
B 66.7
/43.6
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6qs1[1] EA BO3
BORIC ACID[4 atoms]
B 66.7
/43.6
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6qs1[3] FA BO3
BORIC ACID[4 atoms]
B 50.0
/43.6
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6tt4[2] DA BO3
BORIC ACID[4 atoms]
B 66.7
/43.3
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6tt1[2] I BO3
BORIC ACID[4 atoms]
A 0.0
/43.4
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6h5w[1] K BO3
BORIC ACID[4 atoms]
A 0.0
/43.2
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6h5w[2] L BO3
BORIC ACID[4 atoms]
A 62.5
/43.2
8
/8
ACE_HUMAN Angiotensin-converting enzyme
6h5w[2] M BO3
BORIC ACID[4 atoms]
A 100.0
/43.2
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6tt3[2] Z BO3
BORIC ACID[4 atoms]
B 0.0
/43.3
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6h5w[3] J IMD
IMIDAZOLE[5 atoms]
A 42.9
/43.2
7
/7
ACE_HUMAN Angiotensin-converting enzyme
6f9u[1] J IMD
IMIDAZOLE[5 atoms]
A 0.0
/43.1
3
/3
ACE_HUMAN Angiotensin-converting enzyme
6f9t[1] I IMD
IMIDAZOLE[5 atoms]
A 75.0
/43.2
4
/4
ACE_HUMAN Angiotensin-converting enzyme
6f9u[1] G 1PE
PENTAETHYLENE GLYCOL[16 atoms]
A 30.0
/43.1
10
/10
ACE_HUMAN Angiotensin-converting enzyme
2x8y[1] C FLC
CITRATE ANION[13 atoms]
A 50.0
/37.7
10
/10
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
4asq[2] G FLC
CITRATE ANION[13 atoms]
A 66.7
/37.7
6
/6
ACE_DROME ANGIOTENSIN-CONVERTING ENZYME
2x93[5] D EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
A 100.0
/37.7
3
/3
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
2xhm[1] E EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
A 54.5
/37.7
11
/11
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
2x94[6] C EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
A 33.3
/37.7
6
/6
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
2x95[2] E EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
A 25.0
/37.7
8
/8
ACE_DROME ANGIOTENSIN CONVERTING ENZYME
2xy9[1] H EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
A 33.3
/43.6
6
/6
ACE_HUMAN ANGIOTENSIN-CONVERTING ENZYME
5a2r[1] F TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
A 42.9
/37.7
7
/7
ACE_DROME ANGIOTENSIN-CONVERTING ENZYME
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.