#WARNING:no index is registered index 'YP_009724389.1' in 'http://www.uniprot.org/uniprot/'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57566 7096 500 YP_009724389.1()
QUERYSEQ
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELG
TDPYEDFQENWNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI
RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNL
LEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY
ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTE
VLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW
SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAK
KVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE
QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK
SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH
FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSAL
NHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ
ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKP
ASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV
DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAAL
GVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV
VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCE
ESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN
AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKA
CPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST
SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICIST
KHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY
CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVD
RQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW
SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTT
VMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL
AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIIN
NARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD
GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYV
QIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDG
DMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVD
TDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQ
TVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVA
GVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALL
STDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIER
FVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHK
PPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFV
LTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEI
SMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKIL
GLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFIT
REEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYA
CWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSD
KFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR
LQSLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSV
KGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLL
LDDFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLQSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLND
FVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPL
KLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009724389.1()]

7096
region name description
1-7096 DISORDER predicted by DISOPRED (1-21,23-23,30-30,41-43,746-774,882-883,918-1028,1192-1245,1263-1289,1296-1324,1329-1332,1335-1352,1377-1378,1388-1388,1400-1402,1404-1404,1486-1486,1491-1492,1606-1622,2026-2058,2419-2421,2544-2546,2549-2558,2561-2562,2564-2565,2567-2579,2597-2613,2615-2619,2622-2622,2639-2651,2948-2949,3256-3276,3349-3354,3450-3460,3512-3514,3543-3544,3546-3546,3549-3551,3556-3576,3855-3861,3863-3865,3938-3941,3960-4029,4032-4037,4039-4040,4046-4049,4105-4119,4136-4167,4255-4259,4261-4263,4307-4320,4386-4404,4406-4406,4409-4411,4446-4456,4469-4481,4816-4817,4820-4820,4881-4917,4940-4944,4947-4949,4966-4966,5068-5071,5073-5077,5102-5142,5188-5203,5284-5319,5322-5325,5458-5474,5559-5568,5571-5571,5573-5583,5587-5590,5645-5645,5647-5675,5733-5753,5791-5817,5819-5823,5915-5969,6060-6060,6380-6381,6387-6387,6603-6603,6607-6607,6654-6674,6711-6713,6715-6718,6934-6945,7073-7075,7078-7096)

MONOMER
7096
pdb_id a1 identity[%]2 description
7c2k A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
6xez F 100.0 R1AB_SARS2 nsp13
5c8s B 94.9 R1AB_CVHSA Guanine-N7 methyltransferase
6x1b B 100.0 R1AB_SARS2 Uridylate-specific endoribonuclease
6wuu B 98.8 R1AB_SARS2 papain-like protease
6lu7 A 100.0 R1AB_SARS2 main protease
6wks A 100.0 R1AB_SARS2 2'-O-methyltransferase
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez[1] A R1AB_SARS2 nsp12[926 aa] E 100.0
/100.0
3
/3
R1AB_SARS2 nsp13
5nfy[4] H Q1T6X8_CVHSA Polyprotein 1ab[133 aa] C 98.1
/94.7
52
/52
Q1T6X8_CVHSA Polyprotein 1ab
6wkq[21] B R1AB_SARS2 SARS-CoV-2 NSP10[122 aa] A 100.0
/100.0
23
/23
R1AB_SARS2 SARS-CoV-2 NSP16
5c8u[6] A R1AB_CVHSA Non-structural protein 10[133 aa] B 97.9
/94.9
48
/48
R1AB_CVHSA Guanine-N7 methyltransferase
6lu7[6] B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
22
/22
R1AB_SARS2 main protease
2amq[1] C N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/96.0
24
/24
R1AB_CVHSA 3C-like proteinase
6lu7[2] B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
1
/1
R1AB_SARS2 main protease
7ctt[2] D R1AB_SARS2 nsp8[28 aa] A 100.0
/100.0
2
/2
R1AB_SARS2 nsp12
6xqb[1] D R1AB_SARS2 Non-structural protein 8[31 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
6xbi[2] C inhibitor UAW248[5 aa] A 100.0
/100.0
20
/20
R1AB_SARS2 main protease
6xez[1] E R1AB_SARS2 nsp13[596 aa] A 100.0
/100.0
3
/3
R1AB_SARS2 nsp12
6xch[6] B Leupeptin[4 aa] A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
6xbh[2] B inhibitor UAW247[3 aa] A 100.0
/100.0
17
/17
R1AB_SARS2 main protease
6xfn[4] B UAW243[4 aa] A 100.0
/100.0
14
/14
R1AB_SARS2 main protease
7bzf[12] C R1AB_SARS2 Non-structural protein 7[68 aa] A 100.0
/100.0
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
6xez[1] C R1AB_SARS2 nsp7[73 aa] E 100.0
/100.0
1
/1
R1AB_SARS2 nsp13
7bw4[1] C R1AB_SARS2 Replicase polyprotein 1ab[65 aa] A 100.0
/100.0
10
/10
R1AB_SARS2 Replicase polyprotein 1ab
6xaa[1] B J3QS39_HUMAN Ubiquitin-propargylamide[76 aa] A 100.0
/100.0
25
/25
R1AB_SARS2 Papain-like protease
7bv1[1] D R1AB_SARS2 nsp8[99 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 nsp12
7c2k[13] B R1AB_SARS2 Non-structural protein 8[117 aa] A 100.0
/100.0
48
/48
R1AB_SARS2 RNA-directed RNA polymerase
7bw4[1] B R1AB_SARS2 Replicase polyprotein 1ab[115 aa] A 100.0
/100.0
42
/42
R1AB_SARS2 Replicase polyprotein 1ab
7bzf[2] D R1AB_SARS2 Non-structural protein 8[104 aa] A 100.0
/100.0
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
6nur[1] D R1A_CVHSA NSP8[109 aa] A 100.0
/97.0
2
/2
R1AB_CVHSA NSP12
6xez[1] D R1AB_SARS2 nsp8[186 aa] A 100.0
/100.0
12
/12
R1AB_SARS2 nsp12
7c2k[2] D R1AB_SARS2 Non-structural protein 8[139 aa] A 100.0
/100.0
13
/13
R1AB_SARS2 RNA-directed RNA polymerase
6xez[1] B R1AB_SARS2 nsp8[186 aa] F 100.0
/100.0
10
/10
R1AB_SARS2 nsp13
6xez[1] D R1AB_SARS2 nsp8[186 aa] E 100.0
/100.0
4
/4
R1AB_SARS2 nsp13
6m71[1] C R1AB_SARS2 SARS-Cov-2 NSP 8[43 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 SARS-Cov-2 NSP 12
7c8b[1] B Z-VAD(OMe)-FMK[5 aa] A 100.0
/100.0
17
/17
R1AB_SARS2 3C-like proteinase
6xa9[3] B ISG15_HUMAN ISG15 CTD-propargylamide[80 aa] A 100.0
/100.0
22
/22
R1AB_SARS2 Papain-like protease
6wuu[5] F VIR250[5 aa] B 100.0
/98.8
16
/16
R1AB_SARS2 papain-like protease
3snc[2] B Peptide aldehyde inhibitor Ac-NSTSQ-H[6 aa] A 100.0
/96.1
18
/18
R1A_CVHSA 3C-like proteinase
3snd[2] C Peptide aldehyde inhibitor Ac-ESTLQ-H[2 aa] A 100.0
/96.1
12
/12
R1A_CVHSA 3C-like proteinase
3sne[2] B Peptide aldehyde inhibitor Ac-ESTLQ-H[6 aa] A 100.0
/96.1
21
/21
R1A_CVHSA 3C-like proteinase
2z3d[2] B Inhibitor[5 aa] A 100.0
/96.1
18
/18
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
3vb6[1] D C6Z inhibitor[4 aa] B 100.0
/96.1
16
/16
R1A_CVHSA 3C-like proteinase
3vb4[1] C B4Z inhibitor[5 aa] B 100.0
/96.1
1
/1
R1A_CVHSA 3C-like proteinase
3vb5[2] D C4Z inhibitor[5 aa] B 100.0
/96.1
21
/21
R1A_CVHSA 3C-like proteinase
3vb7[1] C M4Z inhibitor[4 aa] B 100.0
/96.1
1
/1
R1A_CVHSA 3C-like proteinase
3vb7[1] D M4Z inhibitor[4 aa] B 100.0
/96.1
17
/17
R1A_CVHSA 3C-like proteinase
3snb[2] B Peptide aldehyde inhibitor Ac-DSFDQ-H[6 aa] A 100.0
/96.1
19
/19
R1A_CVHSA 3C-like proteinase
2z3e[4] B ACE VAL Z3E LEU KCQ peptide[5 aa] A 100.0
/96.1
18
/18
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
3aw0[2] B peptide ACE-SER-ALA-VAL-LEU-HIS-H[6 aa] A 100.0
/95.8
18
/18
R1A_CVHSA 3C-Like Proteinase
2q6g[1] C Polypeptide chain[11 aa] A 100.0
/95.7
24
/24
R1AB_CVHSA severe acute respiratory syndrome coronavirus (SAR..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7bzf[1] F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/100.0
13
/13
R1AB_SARS2 RNA-directed RNA polymerase
6x1b[6] D DNA (5'-R(*GP*U)-3') B 100.0
/100.0
12
/12
R1AB_SARS2 Uridylate-specific endoribonuclease
7bv2[1] D Primer A 100.0
/100.0
15
/15
R1AB_SARS2 nsp12
7bv2[1] E Templete A 100.0
/100.0
26
/26
R1AB_SARS2 nsp12
7jz0[1] F RNA (5'-D(*(M7G))-R(P*(A2M)P*UP*U)-3') C 100.0
/100.0
26
/26
R1AB_SARS2 2'-O-methyltransferase
7ctt[1] E Primer-RNA (5'-R(P*UP*UP*CP*UP*CP*CP*UP*AP*AP*GP*A.. A 100.0
/100.0
18
/18
R1AB_SARS2 nsp12
7bzf[1] E RNA (31-MER) A 100.0
/100.0
25
/25
R1AB_SARS2 RNA-directed RNA polymerase
7c2k[1] F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/100.0
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
7ctt[1] F Template-RNA (5'-R(P*AP*CP*UP*AP*GP*CP*UP*UP*CP*UP.. A 100.0
/100.0
26
/26
R1AB_SARS2 nsp12
7aap[1] D RNA (5'-R(P*UP*UP*AP*AP*GP*UP*UP*AP*U)-3') A 100.0
/100.0
16
/16
R1AB_SARS2 Non-structural protein 12
6yyt[1] E RNA product A 100.0
/100.0
14
/14
R1AB_SARS2 nsp12
6xqb[1] F RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/100.0
19
/19
R1AB_SARS2 RNA-directed RNA polymerase
6xqb[1] E RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/100.0
15
/15
R1AB_SARS2 RNA-directed RNA polymerase
7jyy[2] E RNA (5'-D(*(M7G))-R(P*AP*UP*UP*A)-3') A 100.0
/100.0
26
/26
R1AB_SARS2 2'-O-methyltransferase
7jz0[1] E RNA (5'-D(*(M7G))-R(P*(A2M)P*UP*U)-3') A 100.0
/100.0
26
/26
R1AB_SARS2 2'-O-methyltransferase
7c2k[1] E RNA (29-MER) A 100.0
/100.0
24
/24
R1AB_SARS2 RNA-directed RNA polymerase
6yyt[1] G RNA product A 100.0
/100.0
26
/26
R1AB_SARS2 nsp12
6xez[1] G Product RNA A 100.0
/100.0
16
/16
R1AB_SARS2 nsp12
7aap[1] E RNA (5'-R(P*UP*UP*CP*AP*UP*AP*AP*CP*UP*UP*AP*A)-3'.. A 100.0
/100.0
23
/23
R1AB_SARS2 Non-structural protein 12
6xez[1] H Template RNA A 100.0
/100.0
21
/21
R1AB_SARS2 nsp12
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5rha[4] B T8M
1-{4-[(thiophen-2-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rme[1] C RYM
4-(benzimidazol-1-ylmethyl)benzenecarbonitrile[18 ..
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rli[2] C JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rli[1] I JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5r7y[2] B JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rfu[2] F T8D
1-{4-[(5-chlorothiophen-2-yl)sulfonyl]piperazin-1-..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rlk[1] H NYV
1-(propan-2-yl)-1H-imidazole-4-sulfonamide[12 atom..
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rft[2] E T8A
1-[(4S)-4-phenyl-3,4-dihydroisoquinolin-2(1H)-yl]e..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rfi[2] E T71
1-{4-[(2,5-dimethylphenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rg0[2] F T8Y
1,1'-(piperazine-1,4-diyl)di(ethan-1-one)[12 atoms..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rfz[2] E T8V
N-(2-chloropyridin-3-yl)acetamide[11 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rlo[1] H UQS
N-[(2-fluorophenyl)methyl]-1H-pyrazol-4-amine[14 a..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
7jkv[4] C V7G
N-[(2S)-1-({(1S,2S)-1-(1,3-benzothiazol-2-yl)-1-hy..
A 100.0
/100.0
20
/20
R1AB_SARS2 3C-like proteinase
5rfy[2] E T8S
1-acetyl-N-methyl-N-(propan-2-yl)piperidine-4-carb..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rfx[2] E T8P
1-[4-(4-methoxyphenyl)piperazin-1-yl]ethan-1-one[1..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rmf[1] C NX7
(2,6-difluorophenyl)(pyrrolidin-1-yl)methanone[15 ..
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
6wjt[6] F SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
5c8s[2] K SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
B 100.0
/94.9
14
/14
R1AB_CVHSA Guanine-N7 methyltransferase
5rmj[1] C JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid..
A 100.0
/100.0
10
/10
R1AB_SARS2 Helicase
5rh9[2] F UJ4
N-{4-[(1S)-1-methoxyethyl]phenyl}-N-[(1R)-2-[(4-me..
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
5re5[2] E T0J
N~1~-phenylpiperidine-1,4-dicarboxamide[18 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
7d1o[6] B NNA
(1R,2S,5S)-3-[N-({1-[(tert-butylsulfonyl)methyl]cy..
A 100.0
/100.0
23
/23
R1A_SARS2 3C-like proteinase
5reh[2] E AWP
1-cyclohexyl-3-(2-pyridin-4-ylethyl)urea[18 atoms]..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5re8[2] E T0V
1-(3-fluorophenyl)-N-[(furan-2-yl)methyl]methanami..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rlc[1] H VVM
4-amino-N-phenylbenzene-1-sulfonamide[17 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rl9[1] H UR7
1-(3-fluoro-4-methylphenyl)methanesulfonamide[13 a..
B 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5re7[2] E T0S
N-[(4-sulfamoylphenyl)methyl]acetamide[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rlb[1] C VVJ
N-cycloheptyl-N-methylmethanesulfonamide[13 atoms]..
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rl8[1] D VVG
N-(2-fluorophenyl)ethanesulfonamide[13 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rl8[1] C VVG
N-(2-fluorophenyl)ethanesulfonamide[13 atoms]
A 100.0
/100.0
10
/10
R1AB_SARS2 Helicase
5rmh[1] C VX4
[(4S)-4-methylazepan-1-yl](1,3-thiazol-4-yl)methan..
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rl7[1] I VVD
5-(acetylamino)-2-fluorobenzoic acid[14 atoms]
B 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rl7[1] C VVD
5-(acetylamino)-2-fluorobenzoic acid[14 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5reb[2] E T0Y
1-[(thiophen-3-yl)methyl]piperidin-4-ol[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
6z2e[2] B Q5T
(4~{S})-4-[[(2~{S})-2-[[(2~{S})-2-[[(2~{S})-2-[3-[..
A 100.0
/100.0
21
/21
R1AB_SARS2 Main Protease
5rml[1] H VXD
N-(3-chloro-2-methylphenyl)glycinamide[13 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rmm[1] H VXG
(3S,4S)-1-acetyl-4-phenylpyrrolidine-3-carboxylic ..
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
6wlc[6] M U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
5rfj[2] E T7A
N-(4-methoxy-1,3-benzothiazol-2-yl)acetamide[15 at..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgp[2] E U1M
1-{4-[(2,4-dimethylphenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
7k40[12] B U5G
boceprevir (bound form)[37 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 3C-like proteinase
5rmk[1] H O2A
N-methyl-1H-indole-7-carboxamide[13 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Helicase
5red[2] E JJG
4-[2-(phenylsulfanyl)ethyl]morpholine[15 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
7k1l[6] H UVC
URIDINE-2',3'-VANADATE[21 atoms]
B 100.0
/100.0
14
/14
R1AB_SARS2 Uridylate-specific endoribonuclease
5rfl[2] E T7G
1-acetyl-N-(2-hydroxyphenyl)piperidine-4-carboxami..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rfk[2] E T7D
N-(1-acetylpiperidin-4-yl)benzamide[18 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rf8[2] E SFY
4-amino-N-(pyridin-2-yl)benzenesulfonamide[17 atom..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rfm[2] E T7J
N-[(3R)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
7k1o[6] F VQV
1-(3,5-di-O-phosphono-alpha-L-xylofuranosyl)pyrimi..
B 100.0
/100.0
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
5rlf[1] C NY7
N-(2-methoxy-5-methylphenyl)glycinamide[14 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
6xmk[2] D QYS
(1S,2S)-2-[(N-{[(4,4-difluorocyclohexyl)methoxy]ca..
B 100.0
/100.0
18
/18
R1AB_SARS2 3C-like proteinase
5rfo[2] E T7S
1-[4-(piperidine-1-carbonyl)piperidin-1-yl]ethan-1..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rfn[2] E T7P
N-[(3R)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rln[1] C NZG
3-(acetylamino)-4-fluorobenzoic acid[14 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rfp[2] E T7V
N-[(1S)-1-(3-chlorophenyl)ethyl]acetamide[13 atoms..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
6wkq[1] G SFG
SINEFUNGIN[27 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 SARS-CoV-2 NSP16
6yz1[1] C SFG
SINEFUNGIN[27 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 nsp16
6wq3[2] E 8NK
7-methylguanosine 5'-diphosphate [29 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 2'-O-methyltransferase
5rfs[2] F T84
1-{4-[(thiophen-3-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rfr[2] E T81
1-{4-[(5-bromothiophen-2-yl)methyl]piperazin-1-yl}..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
6yvf[2] B A82
2-[[(1R)-1-(7-methyl-2-morpholin-4-yl-4-oxidanylid..
A 100.0
/100.0
7
/7
R1AB_SARS2 Replicase polyprotein 1ab
5r84[2] B GWS
2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide[16 atoms..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
7c8r[2] B TG3
ethyl (4R)-4-[[(2S)-4-methyl-2-[[(2S,3R)-3-[(2-met..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
7c8r[2] B TG3
ethyl (4R)-4-[[(2S)-4-methyl-2-[[(2S,3R)-3-[(2-met..
A 100.0
/100.0
23
/23
R1AB_SARS2 3C-like proteinase
5rlj[1] H VW4
(2S)-2-phenylpropane-1-sulfonamide[13 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
7bv2[1] K F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-..
A 100.0
/100.0
7
/7
R1AB_SARS2 nsp12
5rlg[1] C VW1
(2S)-2-(4-cyanophenoxy)propanamide[14 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rll[1] H H04
1-(2-ethoxyphenyl)piperazine[15 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rh2[2] B UH7
2-(3-chlorophenyl)-N-(4-methylpyridin-3-yl)acetami..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rh0[2] B UH4
N-(5-methylthiophen-2-yl)-N'-pyridin-3-ylurea[16 a..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rgz[2] B UH1
2-(3-cyanophenyl)-N-(pyridin-3-yl)acetamide[18 ato..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rhf[2] F UPJ
1-acetyl-N-methyl-N-phenylpiperidine-4-carboxamide..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
6wxc[6] M CMU
5-CHLORO-6-(1-(2-IMINOPYRROLIDINYL) METHYL) URACIL..
B 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
5ref[2] E 6SU
methyl 3-(methylsulfonylamino)benzoate[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rmc[1] H 6SU
methyl 3-(methylsulfonylamino)benzoate[15 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rem[2] E T2J
1 1-(4-(2-nitrophenyl)piperazin-1-yl)ethan-1-one[1..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rm4[1] H PK4
2-fluoro-N,3-dimethylbenzene-1-sulfonamide[13 atom..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rgw[2] B UGM
2-(5-cyanopyridin-3-yl)-N-(pyridin-3-yl)acetamide[..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rgv[2] B UGG
2-(isoquinolin-4-yl)-N-phenylacetamide[20 atoms]
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgv[2] B UGG
2-(isoquinolin-4-yl)-N-phenylacetamide[20 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rel[2] E T2G
1-{4-[(3-methylphenyl)methyl]piperazin-1-yl}ethan-..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
7cmd[7] O TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be..
D 100.0
/100.0
9
/9
R1AB_SARS2 Replicase polyprotein 1ab
7jir[1] B TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
5reo[2] E T2Y
N-[(2H-1,3-benzodioxol-5-yl)methyl]acetamide[14 at..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rl6[1] H LJA
N-[3-(carbamoylamino)phenyl]acetamide[14 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rlt[1] H UVJ
3-(2-methyl-1H-benzimidazol-1-yl)propanamide[15 at..
B 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5re4[2] E SZY
N-(4-methylpyridin-3-yl)acetamide[11 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rgy[2] B UGS
N-(4-methoxypyridin-2-yl)-2-(naphthalen-2-yl)aceta..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rlq[1] C UVA
N-methyl-2-(methylsulfonyl)aniline[12 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rgx[2] B UGP
2-(3-cyanophenyl)-N-(4-methylpyridin-3-yl)acetamid..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rlu[1] I JG4
2-(thiophen-2-yl)-1H-imidazole[10 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rlu[1] C JG4
2-(thiophen-2-yl)-1H-imidazole[10 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Helicase
5rh1[2] B UGV
2-(5-chlorothiophen-2-yl)-N-(pyridin-3-yl)acetamid..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5ren[2] E T2V
1-[(3R)-3-(1,3-benzothiazol-2-yl)piperidin-1-yl]et..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5rg2[2] E T9M
N~2~-acetyl-N-prop-2-en-1-yl-D-allothreoninamide[1..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
6w4h[1] G BDF
beta-D-fructopyranose[12 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
6w4h[1] J BDF
beta-D-fructopyranose[12 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
7aap[2] M GE6
[[(2~{R},3~{S},4~{R},5~{R})-5-(3-aminocarbonyl-5-f..
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 12
5rg1[2] E T9J
Nalpha-acetyl-N-(3-bromoprop-2-yn-1-yl)-L-tyrosina..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rm7[1] H N0E
~{N}-(4-hydroxyphenyl)-3-phenyl-propanamide[18 ato..
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rhe[2] B UPD
1-acetyl-N-(6-methoxypyridin-3-yl)piperidine-4-car..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rfe[2] E JGG
N-[(4-cyanophenyl)methyl]morpholine-4-carboxamide[..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
7brp[2] D HU5
(1R,2S,5S)-N-[(1S)-3-AMINO-1-(CYCLOBUTYLMETHYL)-2,..
B 100.0
/100.0
16
/16
R1A_SARS2 3C-like proteinase
6lze[2] F FHR
~{N}-[(2~{S})-3-cyclohexyl-1-oxidanylidene-1-[[(2~..
A 100.0
/100.0
17
/17
R1AB_SARS2 Replicase polyprotein 1ab
5rea[2] E JGP
(azepan-1-yl)(2H-1,3-benzodioxol-5-yl)methanone[18..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rg3[2] F T9P
N~2~-acetyl-N~1~-prop-2-en-1-yl-L-aspartamide[15 a..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rm1[1] H RY4
N-[4-(aminomethyl)phenyl]methanesulfonamide[13 ato..
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
7cx9[2] B GKF
3-iodanyl-1~{H}-indazole-7-carbaldehyde[12 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C protein
5rh4[2] B UHG
(2R)-2-(6-chloro-9H-carbazol-2-yl)propanoic acid[1..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rm3[1] C S7J
2-(trifluoromethyl)pyrimidine-5-carboxamide[13 ato..
A 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
7bq7[11] C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 SARS-CoV-2 nsp16
7c2i[2] C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 Replicase polyprotein 1ab
5c8t[2] R SAM
S-ADENOSYLMETHIONINE[27 atoms]
D 100.0
/94.9
15
/15
R1AB_CVHSA Guanine-N7 methyltransferase
5rfa[2] D JGY
1-methyl-N-{[(2S)-oxolan-2-yl]methyl}-1H-pyrazole-..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rfa[2] D JGY
1-methyl-N-{[(2S)-oxolan-2-yl]methyl}-1H-pyrazole-..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5ree[2] E T1M
(2R,3R)-1-benzyl-2-methylpiperidin-3-ol[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rmb[1] C VWV
ethyl (1,1-dioxo-1lambda~6~,4-thiazinan-4-yl)aceta..
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rh8[2] F UHM
2-(cyanomethoxy)-N-[(1,2-thiazol-4-yl)methyl]benza..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rf9[2] E S7D
1-[(2~{S})-2-methylmorpholin-4-yl]-2-pyrazol-1-yl-..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rec[2] E T1J
2-{[(1H-benzimidazol-2-yl)amino]methyl}phenol[18 a..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5reu[2] E T4D
2-[(4-acetylpiperazin-1-yl)sulfonyl]benzonitrile[2..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rm6[1] H HR5
~{N}-(cyclobutylmethyl)-1,5-dimethyl-pyrazole-4-ca..
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rej[2] E T1V
1-{4-[(thiophen-2-yl)sulfonyl]piperazin-1-yl}ethan..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
7jib[4] I MGP
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE[33 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 2'-O-methyltransferase
5rf6[2] E NTG
5-(1,4-oxazepan-4-yl)pyridine-2-carbonitrile[15 at..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rlv[1] D VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rlv[1] J VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rlv[1] C VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
6x4i[6] C U3P
3'-URIDINEMONOPHOSPHATE[21 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
5rlr[1] H VWD
(1R)-2-(methylsulfonyl)-1-phenylethan-1-ol[13 atom..
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5r82[2] B RZS
6-(ethylamino)pyridine-3-carbonitrile[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rls[1] C VWG
N-hydroxyquinoline-2-carboxamide[14 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rek[2] E T1Y
1-{4-[(3-fluorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rgs[2] E S7V
[(2~{R})-4-(phenylmethyl)morpholin-2-yl]methanol[1..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
6xb2[2] C NEN
1-ETHYL-PYRROLIDINE-2,5-DIONE[9 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6xb1[4] B NEN
1-ETHYL-PYRROLIDINE-2,5-DIONE[9 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5rey[2] E T4Y
1-{4-[(2-methylphenyl)methyl]-1,4-diazepan-1-yl}et..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
6m0k[2] F FJC
~{N}-[(2~{S})-3-(3-fluorophenyl)-1-oxidanylidene-1..
A 100.0
/100.0
17
/17
R1AB_SARS2 Replicase polyprotein 1ab
5rex[2] E T4V
1-{4-[(naphthalen-1-yl)methyl]piperazin-1-yl}ethan..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rh7[2] F UJ1
N-(5-tert-butyl-1H-pyrazol-3-yl)-N-[(1R)-2-[(2-eth..
A 100.0
/100.0
15
/15
R1AB_SARS2 3C-like proteinase
5rev[2] E T4J
N-[3-(thiomorpholine-4-carbonyl)phenyl]acetamide[1..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rhb[2] G USD
(E)-1-(pyrimidin-2-yl)methanimine[8 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rew[2] E T4M
N-[(1R)-1-(naphthalen-1-yl)ethyl]acetamide[16 atom..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
7jiv[2] B VBY
5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
5rle[1] H VVP
4-methoxy-1H-indole[11 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rf5[2] E HV2
1,1-bis(oxidanylidene)thietan-3-ol[7 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rmg[1] H MUK
4,6-dimethyl-~{N}-phenyl-pyrimidin-2-amine[15 atom..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
7ju7[2] B G65
Masitinib[36 atoms]
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5rgh[2] E U0M
5-fluoro-1-[(5-methyl-1,3,4-thiadiazol-2-yl)methyl..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5r7z[2] E HWH
~{N}-[2-(5-fluoranyl-1~{H}-indol-3-yl)ethyl]ethana..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rm2[1] H UXG
1-(diphenylmethyl)azetidin-3-ol[18 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rm2[1] I UXG
1-(diphenylmethyl)azetidin-3-ol[18 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
6wtk[2] B UED
N~2~-[(benzyloxy)carbonyl]-N-{(2S)-1-hydroxy-3-[(3..
A 100.0
/100.0
17
/17
R1AB_SARS2 3C-like proteinase
5rm9[1] H EJQ
~{N}-(4-fluorophenyl)-2-pyrrolidin-1-yl-ethanamide..
B 100.0
/100.0
10
/10
R1AB_SARS2 Helicase
5rlm[1] H VW7
N-(8-methyl-1,2,3,4-tetrahydroquinolin-5-yl)acetam..
B 100.0
/100.0
3
/3
R1AB_SARS2 Helicase
5r83[2] E K0G
N-phenyl-N'-pyridin-3-ylurea[16 atoms]
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgk[2] E U0V
2-fluoro-N-[2-(pyridin-4-yl)ethyl]benzamide[18 ato..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rgj[2] E U0S
(5S)-7-(pyrazin-2-yl)-2-oxa-7-azaspiro[4.4]nonane[..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rgi[2] E U0P
N'-cyclopropyl-N-methyl-N-[(5-methyl-1,2-oxazol-3-..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rgi[2] E U0P
N'-cyclopropyl-N-methyl-N-[(5-methyl-1,2-oxazol-3-..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rm5[1] H NUA
N-(1-ethyl-1H-pyrazol-4-yl)cyclobutanecarboxamide[..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
7jpe[5] C GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 100.0
/100.0
17
/17
R1AB_SARS2 2'-O-methyltransferase
6wks[1] E GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 100.0
/100.0
17
/17
R1AB_SARS2 2'-O-methyltransferase
5rfg[2] E T6V
N-[(3S)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
6xez[2] Y ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
F 100.0
/100.0
9
/9
R1AB_SARS2 nsp13
6xez[1] L ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 100.0
/100.0
11
/11
R1AB_SARS2 nsp12
6w79[4] C X77
N-(4-tert-butylphenyl)-N-[(1R)-2-(cyclohexylamino)..
A 100.0
/96.1
17
/17
Main protease
5rgl[2] E U0Y
1-[4-(4-methylbenzene-1-carbonyl)piperazin-1-yl]et..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rlw[1] I S9S
~{N}-[2-(4-fluorophenyl)ethyl]methanesulfonamide[1..
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rlw[1] C S9S
~{N}-[2-(4-fluorophenyl)ethyl]methanesulfonamide[1..
A 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
6xqs[9] B SV6
(1S,3aR,6aS)-2-[(2S)-2-({(2S)-2-cyclohexyl-2-[(pyr..
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
6wvn[1] Q ADE
ADENINE[10 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] R ADE
ADENINE[10 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wks[1] D ADN
ADENOSINE[19 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 2'-O-methyltransferase
6y2f[4] C O6K
~{tert}-butyl ~{N}-[1-[(2~{S})-3-cyclopropyl-1-oxi..
A 100.0
/100.0
18
/18
R1AB_SARS2 Replicase polyprotein 1ab
6y2g[1] D O6K
~{tert}-butyl ~{N}-[1-[(2~{S})-3-cyclopropyl-1-oxi..
B 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
5re9[2] E LPZ
2-(4-methylphenoxy)-1-(4-methylpiperazin-4-ium-1-y..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
6xhm[1] C V2M
N-[(2S)-1-({(2S)-4-hydroxy-3-oxo-1-[(3S)-2-oxopyrr..
B 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
6xhm[2] E V2M
N-[(2S)-1-({(2S)-4-hydroxy-3-oxo-1-[(3S)-2-oxopyrr..
B 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
5rmd[2] C VWY
N-ethyl-4-[(methylsulfonyl)amino]benzamide[16 atom..
A 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rer[2] E T3J
1-[(2R)-2-(4-fluorophenyl)morpholin-4-yl]ethan-1-o..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
6m2n[4] F 3WL
5,6,7-trihydroxy-2-phenyl-4H-chromen-4-one[20 atom..
B 100.0
/100.0
15
/15
SARS-CoV-2 3CL protease
5rgn[2] E U1A
1-{4-[(4-methylphenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rep[2] E T3G
1-{4-[(2,6-difluorophenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rfc[2] E K1Y
methyl (2-methyl-4-phenyl-1,3-thiazol-5-yl)carbama..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rh3[2] B UHA
(2R)-2-(3-chlorophenyl)-N-(4-methylpyridin-3-yl)pr..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5ret[2] E T47
1-{4-[(3-chlorophenyl)methyl]piperazin-1-yl}ethan-..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgm[2] E U1D
N'-acetyl-4,5,6,7-tetrahydro-1-benzothiophene-2-ca..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgo[2] E U1G
1-[4-(furan-2-carbonyl)piperazin-1-yl]ethan-1-one[..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rgr[2] E K1G
N,1-dimethyl-N-(propan-2-yl)-1H-pyrazolo[3,4-d]pyr..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rgr[2] D K1G
N,1-dimethyl-N-(propan-2-yl)-1H-pyrazolo[3,4-d]pyr..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5res[2] E T3V
1-{4-[(2-fluorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
7buy[2] B JRY
hexylcarbamic acid[9 atoms]
A 100.0
/100.0
8
/8
SARS-CoV-2 virus Main protease
5rgq[2] D U1V
1-(4-fluoro-2-methylphenyl)methanesulfonamide[13 a..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rgq[2] D U1V
1-(4-fluoro-2-methylphenyl)methanesulfonamide[13 a..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rly[1] I K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rly[1] C K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rly[1] J K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
7cbt[2] D K36
(1S,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino..
B 100.0
/100.0
15
/15
R1AB_SARS2 Replicase polyprotein 1ab
7c8u[9] B K36
(1S,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino..
A 100.0
/100.0
13
/13
R1AB_SARS2 Replicase polyprotein 1ab
6wtj[2] B K36
(1S,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rfh[2] E T6Y
1-{4-[(5-chlorothiophen-2-yl)methyl]piperazin-1-yl..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rm8[1] C GQJ
methyl (2~{S},4~{R})-1-(furan-2-ylcarbonyl)-4-oxid..
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rhc[2] B USA
(E)-1-(1H-imidazol-2-yl)methanimine[7 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
6yt8[2] B PK8
9-oxa-7-thia-1-azonia-8$l^{2}-zincabicyclo[4.3.0]n..
A 100.0
/100.0
6
/6
R1AB_SARS2 Replicase polyprotein 1ab
5rma[1] H JHJ
N-(4-methoxyphenyl)-N'-pyridin-4-ylurea[18 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
7jn2[1] B Y41
3-amino-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]..
A 100.0
/100.0
10
/10
R1A_SARS2 Papain-Like Protease
5rff[2] E T6M
1-{4-[(4-chlorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rm0[1] H S7G
~{N}-[(3~{R})-1,2,3,4-tetrahydroquinolin-3-yl]etha..
B 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rfd[2] E T6J
2-[(methylsulfonyl)methyl]-1H-benzimidazole[14 ato..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5reg[2] E LWA
(2~{S})-~{N}-(4-aminocarbonylphenyl)oxolane-2-carb..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rfv[2] E T8J
1-[4-(thiophene-2-carbonyl)piperazin-1-yl]ethan-1-..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
6ynq[2] B P6N
(2~{S})-2-methyl-3,4-dihydro-2~{H}-naphthalen-1-on..
A 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6ynq[2] B P6N
(2~{S})-2-methyl-3,4-dihydro-2~{H}-naphthalen-1-on..
A 100.0
/100.0
8
/8
R1AB_SARS2 Replicase polyprotein 1ab
5rh5[2] B UHV
N-(5-tert-butyl-1,2-oxazol-3-yl)-N-[(1R)-2-[(4-met..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
6wtt[1] N UCS
N~2~-[(benzyloxy)carbonyl]-N-[(1R,2S)-1-hydroxy-3-..
B 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
6wtt[1] N UCS
N~2~-[(benzyloxy)carbonyl]-N-[(1R,2S)-1-hydroxy-3-..
C 100.0
/100.0
20
/20
R1AB_SARS2 3C-like proteinase
5rlz[1] C VWM
(3R)-1-acetyl-3-hydroxypiperidine-3-carboxylic aci..
A 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rlh[1] H K2P
2-(trifluoromethoxy)benzoic acid[14 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rez[2] E T54
(1R,2S)-2-(thiophen-3-yl)cyclopentane-1-carboxamid..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
7jhe[1] E V9G
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-(2'-O-METHYL..
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
7c7p[1] E FK3
(3~{S},3~{a}~{S},6~{a}~{R})-~{N}-[(2~{R},3~{S})-1-..
B 100.0
/100.0
13
/13
R1AB_SARS2 main protease
5rgt[2] F UHS
N-[(1R)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5r80[2] E RZG
methyl 4-sulfamoylbenzoate[14 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rf4[2] E T5Y
pyridin-2-ol[7 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5re6[2] E O0S
N-{4-[(pyrimidin-2-yl)oxy]phenyl}acetamide[17 atom..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rei[2] E T1S
4-[(3-chlorophenyl)methyl]morpholine[14 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5r81[2] B RZJ
1-methyl-3,4-dihydro-2~{H}-quinoline-7-sulfonamide..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rf3[2] E T5V
pyrimidin-5-amine[7 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rmi[1] C STV
~{N}-(1,3-benzodioxol-5-ylmethyl)ethanesulfonamide..
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
6xez[1] U 1N7
CHAPSO[36 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 nsp12
6xez[1] N 1N7
CHAPSO[26 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 nsp12
6xez[1] M 1N7
CHAPSO[35 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 nsp12
6xez[1] U 1N7
CHAPSO[36 atoms]
E 100.0
/100.0
3
/3
R1AB_SARS2 nsp13
5rgg[2] E NZD
4-methyl-N-phenylpiperazine-1-carboxamide[16 atoms..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rf0[2] E T5D
[1-(pyridin-2-yl)cyclopentyl]methanol[13 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rf0[2] E T5D
[1-(pyridin-2-yl)cyclopentyl]methanol[13 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5rgu[2] B UGD
N-(3-{[(2R)-4-oxoazetidin-2-yl]oxy}phenyl)-2-(pyri..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5rf1[2] E T5G
4-bromobenzene-1-sulfonamide[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rfb[2] E K3S
N-[(1-methyl-1H-1,2,3-triazol-4-yl)methyl]ethanami..
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5rf7[2] E T67
1-(4-methylpiperazin-1-yl)-2-(1H-pyrrolo[2,3-b]pyr..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5rld[1] H VVY
2-phenoxy-1-(pyrrolidin-1-yl)ethan-1-one[15 atoms]..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rlp[1] H VWA
(1S)-1-(4-fluorophenyl)-N-methylethan-1-amine[11 a..
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rhd[2] I US7
1-[4-(methylsulfonyl)phenyl]piperazine[16 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rfq[2] E T7Y
N-[3-(2-oxopyrrolidin-1-yl)phenyl]acetamide[16 ato..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rh6[2] F UHY
N-[(1R)-2-[(2-ethyl-6-methylphenyl)amino]-2-oxo-1-..
A 100.0
/100.0
15
/15
R1AB_SARS2 3C-like proteinase
7jit[1] B Y95
5-[(carbamoylcarbamoyl)amino]-2-methyl-N-[(1R)-1-(..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
6lny[1] B EOC
(2~{S})-4-methyl-~{N}-[(2~{S})-1-oxidanylidene-3-[..
A 100.0
/96.1
16
/16
R1A_CVHSA Replicase polyprotein 1a
6lo0[1] B EOF
(2~{S})-4-methyl-~{N}-[(2~{S})-1-oxidanylidene-3-[..
A 100.0
/96.1
18
/18
R1A_CVHSA Replicase polyprotein 1a
2v6n[2] B XP1
4-(DIMETHYLAMINO)BENZOIC ACID[11 atoms]
A 100.0
/96.1
10
/10
R1AB_CVHSA REPLICASE POLYPROTEIN 1AB
5n5o[2] B 8O5
(2~{R},3~{S})-3-[[(2~{S})-3-cyclopropyl-2-[[(~{E})..
A 100.0
/96.1
17
/17
R1AB_CVHSA Replicase polyprotein 1ab
6wco[2] D X47
N-(4-tert-butylphenyl)-N-[(1R)-2-(cyclopentylamino..
A 100.0
/96.1
17
/17
A0A3G5BIY8_CVHSA Main protease
6y7m[2] B OEW
~{tert}-butyl ~{N}-[1-[(2~{S})-3-cyclohexyl-1-[[(2..
A 100.0
/96.1
20
/20
R1A_CVHSA Replicase polyprotein 1a
5n19[2] B D03
(S)-N-benzyl-3-((S)-2-cinnamamido-3-phenylpropanam..
A 95.2
/96.1
21
/21
R1AB_CVHSA SARS coronavirus main protease
3szn[2] B G75
ETHYL (4R)-4-({N-[(BENZYLOXY)CARBONYL]-L-PHENYLALA..
A 100.0
/96.1
17
/17
R1A_CVHSA 3C-like proteinase
2gx4[2] B NOL
N-[(BENZYLOXY)CARBONYL]-O-(TERT-BUTYL)-L-THREONYL-..
A 100.0
/96.1
1
/1
R1AB_CVHSA 3C-like proteinase
7c8t[4] B NOL
N-[(BENZYLOXY)CARBONYL]-O-(TERT-BUTYL)-L-THREONYL-..
A 100.0
/100.0
23
/23
R1AB_SARS2 3C-like proteinase
2gz8[2] B F3F
S-[5-(TRIFLUOROMETHYL)-4H-1,2,4-TRIAZOL-3-YL] 5-(P..
A 100.0
/96.1
14
/14
R1AB_CVHSA Replicase polyprotein 1ab
2z94[2] C TLD
4-methylbenzene-1,2-dithiol[9 atoms]
A 100.0
/96.1
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
2zu4[2] B ZU3
N-[(benzyloxy)carbonyl]-3-[(2,2-dimethylpropanoyl)..
A 100.0
/96.1
22
/22
R1A_CVHSA 3C-like proteinase
2zu4[2] B ZU3
N-[(benzyloxy)carbonyl]-3-[(2,2-dimethylpropanoyl)..
A 100.0
/96.1
1
/1
R1A_CVHSA 3C-like proteinase
2zu5[2] B ZU5
N-[(benzyloxy)carbonyl]-O-tert-butyl-L-threonyl-N-..
A 100.0
/96.1
1
/1
R1A_CVHSA 3C-like proteinase
2zu5[2] B ZU5
N-[(benzyloxy)carbonyl]-O-tert-butyl-L-threonyl-N-..
A 100.0
/96.1
22
/22
R1A_CVHSA 3C-like proteinase
3sn8[2] B S89
N-[(2S)-1-hydroxy-3-phenylpropan-2-yl]-Nalpha-[(2E..
A 100.0
/96.1
15
/15
R1A_CVHSA 3C-like proteinase
2a5i[3] B AZP
(5S,8S,14R)-ETHYL 11-(3-AMINO-3-OXOPROPYL)-8-BENZY..
A 100.0
/96.1
23
/23
R1AB_CVHSA 3C-like peptidase
6lnq[1] B EJF
N-[(2S)-3-methyl-1-[[(2S)-4-methyl-1-oxidanylidene..
A 100.0
/96.1
19
/19
Severe Acute Respiratory Syndrome Coronavirus 3c L..
3tnt[2] B G85
N-[(benzyloxy)carbonyl]-O-tert-butyl-L-seryl-N-{(2..
A 100.0
/96.1
22
/22
R1A_CVHSA SARS coronavirus main protease
3v3m[2] B 0EN
N-[(1R)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)..
A 100.0
/96.1
15
/15
R1A_CVHSA 3C-like proteinase
3tit[2] B G81
ETHYL (4R)-4-{[N-(TERT-BUTOXYCARBONYL)-L-PHENYLALA..
A 100.0
/96.1
15
/15
R1A_CVHSA SARS coronavirus main protease
3tiu[2] C G82
ETHYL (5S,8S,11R)-8-BENZYL-5-(3-TERT-BUTOXY-3-OXOP..
A 100.0
/96.1
23
/23
R1A_CVHSA SARS coronavirus main protease
3tns[2] B G83
ETHYL (5S,8S,11R)-8-BENZYL-5-(2-TERT-BUTOXY-2-OXOE..
A 100.0
/96.1
1
/1
R1A_CVHSA SARS coronavirus main protease
3tns[2] B G83
ETHYL (5S,8S,11R)-8-BENZYL-5-(2-TERT-BUTOXY-2-OXOE..
A 100.0
/96.1
24
/24
R1A_CVHSA SARS coronavirus main protease
2gz7[2] B D3F
2-[(2,4-DICHLORO-5-METHYLPHENYL)SULFONYL]-1,3-DINI..
A 100.0
/96.1
13
/13
R1AB_CVHSA Replicase polyprotein 1ab
2amd[2] D 9IN
N-(3-FUROYL)-D-VALYL-L-VALYL-N~1~-((1R,2Z)-4-ETHOX..
B 100.0
/96.0
22
/22
R1AB_CVHSA 3C-like proteinase
1wof[2] C I12
N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]-L-ALANYL-L-VAL..
A 100.0
/96.1
23
/23
R1AB_CVHSA 3C-like proteinase
2alv[2] B CY6
N-((3S,6R)-6-((S,E)-4-ETHOXYCARBONYL-1-((S)-2-OXOP..
A 100.0
/96.0
24
/24
R1AB_CVHSA Replicase polyprotein 1ab
4mds[2] B 23H
N-[4-(acetylamino)phenyl]-2-(1H-benzotriazol-1-yl)..
A 94.4
/96.0
18
/18
R1A_CVHSA 3C-like proteinase
4wy3[1] B 3X5
(2S)-2-({[(3R,4aS,8aR)-2-(biphenyl-4-ylcarbonyl)de..
A 93.8
/95.8
16
/16
R1AB_CVHSA 3C-like proteinase
4twy[2] B 3BL
(2S)-2-({[(3S,4aR,8aS)-2-(biphenyl-4-ylcarbonyl)de..
A 88.9
/95.8
18
/18
R1AB_CVHSA 3C-like proteinase
5c5n[2] B SLH
(2S)-3-(1H-imidazol-5-yl)-2-({[(3R,4aS,8aR)-2-(N-p..
A 93.3
/95.8
15
/15
R1AB_CVHSA 3C-like proteinase
4tww[2] C 3A7
(2S)-2-({[(3S,4aR,8aS)-2-(4-bromobenzoyl)decahydro..
A 93.3
/95.8
15
/15
R1AB_CVHSA 3C-like proteinase
5c8s[2] L G3A
GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms..
B 100.0
/94.9
16
/16
R1AB_CVHSA Guanine-N7 methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5rlr[102] J ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
7jit[11] D ZN
ZINC ION[1 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
7jit[7] F ZN
ZINC ION[1 atoms]
A 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
5rmb[102] E ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rm2[102] C ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
7jrn[30] H ZN
ZINC ION[1 atoms]
B 100.0
/100.0
5
/5
R1A_SARS2 Papain-like proteinase
5nfy[4] R ZN
ZINC ION[1 atoms]
C 100.0
/94.7
4
/4
Q1T6X8_CVHSA Polyprotein 1ab
6xqb[3] H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
7c2k[3] H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
5c8u[4] M ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
7bw4[1] E ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
7aap[5] G ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 12
7bv2[4] F ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 nsp12
5nfy[4] W ZN
ZINC ION[1 atoms]
D 100.0
/94.7
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
5wwp[5] C ZN
ZINC ION[1 atoms]
A 100.0
/72.3
4
/4
K0BWD0_9BETC ORF1ab
5wwp[5] E ZN
ZINC ION[1 atoms]
A 100.0
/72.3
4
/4
K0BWD0_9BETC ORF1ab
6xez[2] V ZN
ZINC ION[1 atoms]
F 100.0
/100.0
5
/5
R1AB_SARS2 nsp13
7cmd[4] Q ZN
ZINC ION[1 atoms]
D 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6yyt[1] I ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 nsp12
5nfy[4] N ZN
ZINC ION[1 atoms]
B 100.0
/94.7
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
6yyt[1] J ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 nsp12
6xez[2] X ZN
ZINC ION[1 atoms]
F 100.0
/100.0
4
/4
R1AB_SARS2 nsp13
7cjm[1] C ZN
ZINC ION[1 atoms]
A 100.0
/99.7
1
/1
R1AB_SARS2 Non-structural protein 3
7cmd[1] G ZN
ZINC ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
5c8s[2] I ZN
ZINC ION[1 atoms]
B 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[4] O ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8u[4] O ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
7jn2[2] G ZN
ZINC ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-Like Protease
6nur[4] E ZN
ZINC ION[1 atoms]
A 100.0
/97.0
4
/4
R1AB_CVHSA NSP12
7jiw[5] D ZN
ZINC ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-Like Protease
7aap[5] H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 12
5c8s[2] P ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
7cmd[1] K ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
5c8s[2] O ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
7bw4[1] F ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
7cjm[1] D ZN
ZINC ION[1 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
7cx9[2] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C protein
5r7y[3] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
7jit[10] H CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7c8b[2] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
6wtt[1] O CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
6wtt[1] L CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
6xkf[11] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
6wtt[2] I CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
6wtt[2] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
6wrh[2] F CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
3
/3
R1AB_SARS2 Non-structural protein 3
6wvn[2] DA CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6yt8[2] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
7jir[12] G CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
6
/6
R1A_SARS2 Papain-like protease
6vww[3] L CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6yz6[12] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Main Protease
6yvf[5] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
7jib[1] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6z2e[2] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Main Protease
7jyy[2] J CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/4
R1AB_SARS2 2'-O-methyltransferase
2a5a[2] B CL
CHLORIDE ION[1 atoms]
A 100.0
/96.1
2
/2
R1AB_CVHSA 3C-like peptidase
7jz0[1] Y CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
7jz0[1] Z CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
7jir[2] J CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
6wrz[5] O CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] K CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6yvf[2] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
6xkm[1] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6w61[1] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
7jz0[1] AA CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wrz[1] P CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] L CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] H CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
7jn2[2] N UNX
UNKNOWN ATOM OR ION[1 atoms]
A 100.0
/100.0
1
/1
R1A_SARS2 Papain-Like Protease
7jyy[7] T NA
SODIUM ION[1 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6xbg[1] H NA
SODIUM ION[1 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 main protease
7jz0[2] U NA
SODIUM ION[1 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6z2e[2] E NA
SODIUM ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Main Protease
7jyy[1] S NA
SODIUM ION[1 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6xbi[1] G NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 main protease
7jyc[4] G NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
6wkq[1] F NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
6x4i[3] P NA
SODIUM ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
6xbh[2] D NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 main protease
6yvf[2] L CA
CALCIUM ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
2z9g[2] B HG
MERCURY (II) ION[1 atoms]
A 100.0
/96.1
4
/4
R1AB_CVHSA 3C-like proteinase
6xez[2] AA MG
MAGNESIUM ION[1 atoms]
F 100.0
/100.0
3
/3
R1AB_SARS2 nsp13
7bv2[2] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 nsp12
6vww[3] E MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6wuu[1] K MG
MAGNESIUM ION[1 atoms]
B 100.0
/98.8
1
/1
R1AB_SARS2 papain-like protease
7aap[3] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 12
6wtt[3] J MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
5c8u[4] P MG
MAGNESIUM ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
7jyy[2] H MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6xez[2] K MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 nsp12
6wuu[1] O MG
MAGNESIUM ION[1 atoms]
D 100.0
/99.7
5
/5
R1AB_SARS2 papain-like protease
6wtt[1] M MG
MAGNESIUM ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5c8s[2] J MG
MAGNESIUM ION[1 atoms]
B 100.0
/94.9
3
/3
R1AB_CVHSA Guanine-N7 methyltransferase
6wuu[1] P MG
MAGNESIUM ION[1 atoms]
D 100.0
/99.7
2
/2
R1AB_SARS2 papain-like protease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7k1l[54] B R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] B 100.0
/100.0
26
/26
R1AB_SARS2 Uridylate-specific endoribonuclease
7k1o[54] A R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] C 100.0
/100.0
25
/25
R1AB_SARS2 Uridylate-specific endoribonuclease
7k1o[48] A R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] C 100.0
/100.0
16
/18
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[12] A R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6xez[1] E R1AB_SARS2 nsp13[596 aa] F 100.0
/100.0
5
/5
R1AB_SARS2 nsp13
6xez[1] F R1AB_SARS2 nsp13[596 aa] E 100.0
/100.0
4
/4
R1AB_SARS2 nsp13
7cjd[9] B R1AB_SARS2 Replicase polyprotein 1ab[297 aa] D 100.0
/99.7
14
/14
R1AB_SARS2 Replicase polyprotein 1ab
7cjd[2] A R1AB_SARS2 Replicase polyprotein 1ab[313 aa] D 100.0
/99.7
15
/15
R1AB_SARS2 Replicase polyprotein 1ab
6xg3[2] A R1AB_SARS2 Peptidase C16[313 aa] A 100.0
/99.7
24
/24
R1AB_SARS2 Peptidase C16
7cjd[1] B R1AB_SARS2 Replicase polyprotein 1ab[297 aa] A 100.0
/99.7
10
/10
R1AB_SARS2 Replicase polyprotein 1ab
7cjd[1] D R1AB_SARS2 Replicase polyprotein 1ab[310 aa] A 100.0
/99.7
14
/14
R1AB_SARS2 Replicase polyprotein 1ab
5rgm[485] A R1AB_SARS2 3C-like proteinase[304 aa] A 100.0
/100.0
37
/37
R1AB_SARS2 3C-like proteinase
2z3e[2] A R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)[306 aa] A 80.0
/96.1
5
/5
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
7cbt[2] B R1AB_SARS2 Replicase polyprotein 1ab[298 aa] A 100.0
/100.0
26
/26
R1AB_SARS2 Replicase polyprotein 1ab
2rhb[12] F R1AB_CVHSA Uridylate-specific endoribonuclease[344 aa] D 86.7
/88.4
30
/30
R1AB_CVHSA Uridylate-specific endoribonuclease
2rhb[6] C R1AB_CVHSA Uridylate-specific endoribonuclease[345 aa] F 92.9
/88.4
14
/14
R1AB_CVHSA Uridylate-specific endoribonuclease
2h85[6] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 93.3
/88.2
15
/16
Q6VA80_CVHSA Putative orf1ab polyprotein
2h85[6] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 85.2
/88.2
27
/27
Q6VA80_CVHSA Putative orf1ab polyprotein
2rhb[6] F R1AB_CVHSA Uridylate-specific endoribonuclease[344 aa] E 88.0
/88.4
25
/25
R1AB_CVHSA Uridylate-specific endoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xdh[6] H ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[3] K ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[4] T ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] S ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] Q ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
7k1l[3] E ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[6] C ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6w4h[1] E ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6wlc[3] F ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
6xkh[2] H ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
7jit[3] K ACT
ACETATE ION[4 atoms]
A 85.7
/99.7
7
/7
R1A_SARS2 Papain-like protease
6w4h[1] F ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 SARS-CoV-2 NSP16
7jn2[1] L ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-Like Protease
7jkv[1] E 1PE
PENTAETHYLENE GLYCOL[16 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rg3[246] B DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rf1[260] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rf1[258] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rgy[14] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rgy[66] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rgx[50] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rg3[244] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6lze[16] B DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Replicase polyprotein 1ab
7k3t[22] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
6w79[26] B DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/96.1
1
/1
Main protease
7k3t[10] L DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rfw[18] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
7buy[2] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
4
/4
SARS-CoV-2 virus Main protease
7buy[2] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
SARS-CoV-2 virus Main protease
6yz6[2] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Main Protease
6m0k[2] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
3tiu[2] B DMS
DIMETHYL SULFOXIDE[4 atoms]
A 83.3
/96.1
6
/6
R1A_CVHSA SARS coronavirus main protease
5rhd[2] H DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
7k3t[2] K DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6xbi[1] H DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 main protease
6xbi[1] H DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 main protease
6w01[12] N CIT
CITRIC ACID[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] O ACY
ACETIC ACID[4 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] H ACY
ACETIC ACID[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] P ACY
ACETIC ACID[4 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
7aap[1] K POP
PYROPHOSPHATE 2-[9 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 12
7bv2[1] H POP
PYROPHOSPHATE 2-[9 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 nsp12
6xmk[1] E PG4
TETRAETHYLENE GLYCOL[13 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rlr[208] L PO4
PHOSPHATE ION[5 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
6xg3[3] C PO4
PHOSPHATE ION[5 atoms]
A 83.3
/99.7
6
/6
R1AB_SARS2 Peptidase C16
6wrh[2] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
6wzu[2] E PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
6wxc[12] N PO4
PHOSPHATE ION[5 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6xez[2] Z AF3
ALUMINUM FLUORIDE[4 atoms]
F 100.0
/100.0
6
/6
R1AB_SARS2 nsp13
6vww[3] N GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[6] F GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
7ju7[2] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
6xbg[16] G GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 main protease
6vww[6] G GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6xbi[1] F GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 main protease
6wtt[2] F GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6xa9[15] I GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Papain-like protease
6vww[3] I GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6wrh[2] I GOL
GLYCEROL[6 atoms]
A 100.0
/99.7
6
/6
R1AB_SARS2 Non-structural protein 3
6xa9[2] L GOL
GLYCEROL[6 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 Papain-like protease
6wzu[2] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
6xa9[2] P GOL
GLYCEROL[6 atoms]
E 100.0
/100.0
2
/2
R1AB_SARS2 Papain-like protease
2z3e[2] D GOL
GLYCEROL[6 atoms]
A 100.0
/96.1
4
/4
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
7cx9[2] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C protein
6vww[3] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
3vb4[1] K GOL
GLYCEROL[6 atoms]
B 100.0
/96.1
4
/4
R1A_CVHSA 3C-like proteinase
6xbi[1] E GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 main protease
3vb7[1] H GOL
GLYCEROL[6 atoms]
B 83.3
/96.1
6
/6
R1A_CVHSA 3C-like proteinase
6xa9[3] G GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Papain-like protease
7ju7[2] E GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
6yt8[2] C IMD
IMIDAZOLE[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
6yz6[2] E IMD
IMIDAZOLE[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Main Protease
6w75[3] O FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[7] H FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[10] J FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[1] L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
6xkh[5] D FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
6xdh[3] M FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[3] G FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wkq[4] L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6wkq[1] H FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
6xdh[3] F FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] U FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[6] Q FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
7jfq[2] E FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
6wjt[1] K FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
7jfq[2] C FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
6xdh[3] I FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[6] E FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[3] P FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] V FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6xkh[2] E FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
7jz0[1] CA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6xkh[2] F FMT
FORMIC ACID[3 atoms]
A 85.7
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
7jz0[1] L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
7jz0[1] N FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6xkh[2] G FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
6w75[1] K FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
6wjt[1] L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6wlc[3] U FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wjt[1] P FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
7jyy[1] N FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
7jz0[1] M FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6w4h[1] C SO3
SULFITE ION[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
6wq3[2] K SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] Z SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6wrz[4] F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
7jrn[2] F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like proteinase
2v6n[2] D SO4
SULFATE ION[5 atoms]
A 100.0
/96.1
2
/2
R1AB_CVHSA REPLICASE POLYPROTEIN 1AB
7k1l[6] G SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6wq3[6] I SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wlc[3] L SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6wrz[4] K SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 2'-O-methyltransferase
6wrz[2] M SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wvn[3] U SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] Y SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
7jrn[1] I SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
3
/3
R1A_SARS2 Papain-like proteinase
7jrn[1] J SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
5
/5
R1A_SARS2 Papain-like proteinase
7jrn[1] E SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like proteinase
6wrz[1] L SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wlc[3] N TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[6] N TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6y2g[1] C GLY
GLYCINE[4 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6y2g[1] C GLY
GLYCINE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
5rf2[2] E HVB
1-azanylpropylideneazanium[5 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
6wxc[6] I EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[40] L EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[12] N EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[12] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[9] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[15] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
3vb4[13] H EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/96.1
5
/5
R1A_CVHSA 3C-like proteinase
6xkh[2] B EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6wlc[29] P EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[6] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
3vb4[3] J EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/96.1
4
/4
R1A_CVHSA 3C-like proteinase
7k1o[12] I EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[24] L EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
7k1l[3] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6x1b[3] G EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[3] X EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6xoa[35] F EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/99.7
2
/2
R1AB_SARS2 3C-like proteinase
6x4i[6] S EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] L EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[3] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6x1b[3] H EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] V EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[3] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[6] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6xkh[2] C EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
3vb4[1] L EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/96.1
5
/5
R1A_CVHSA 3C-like proteinase
6w01[3] M EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
3vb5[2] F EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/96.1
2
/2
R1A_CVHSA 3C-like proteinase
7k1l[3] F EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
3vb3[1] I EDO
1,2-ETHANEDIOL[4 atoms]
B 66.7
/96.1
3
/3
R1A_CVHSA 3C-like proteinase
3vb3[5] J EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/96.1
5
/5
R1A_CVHSA 3C-like proteinase
6w01[3] S EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6xkf[1] C EDO
1,2-ETHANEDIOL[4 atoms]
A 80.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
6w61[1] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 2'-O-methyltransferase
2z9g[2] C BNZ
BENZENE[6 atoms]
A 100.0
/96.1
7
/7
R1AB_CVHSA 3C-like proteinase
2z9k[2] E DOZ
(dimethylamino)(hydroxy)zinc'[5 atoms]
A 100.0
/96.1
5
/5
R1AB_CVHSA 3C-like proteinase
5nfy[2] T PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
C 100.0
/94.7
1
/1
Q1T6X8_CVHSA Polyprotein 1ab
6w01[6] AA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6yvf[2] K PEG
DI(HYDROXYETHYL)ETHER[6 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6yt8[2] E PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
6yvf[2] J PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
6w01[3] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
6yvf[2] I PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
6yt8[2] F PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Replicase polyprotein 1ab
6wtt[2] E PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
3vb3[1] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 100.0
/96.1
3
/3
R1A_CVHSA 3C-like proteinase
3snd[1] E MRD
(4R)-2-METHYLPENTANE-2,4-DIOL[8 atoms]
A 83.3
/96.1
6
/6
R1A_CVHSA 3C-like proteinase
6wco[4] C MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/96.1
3
/3
A0A3G5BIY8_CVHSA Main protease
6w79[8] D MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 80.0
/96.1
5
/5
Main protease
7jir[3] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
7jiw[1] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
6
/6
R1A_SARS2 Papain-Like Protease
6yz1[1] D MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 nsp16
2z9j[2] H DTZ
zinc(II)hydrogensulfide[3 atoms]
B 100.0
/96.1
3
/3
R1AB_CVHSA 3C-like proteinase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.