#WARNING:no index is registered index 'YP_009725297.1' in 'http://www.uniprot.org/uniprot/'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
35937 180 10 YP_009725297.1()
QUERYSEQ
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELG
TDPYEDFQENWNTKHSSGVTRELMRELNGG
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725297.1()]

180
region name description
1-180 DISORDER predicted by DISOPRED (1-4,180-180)

MONOMER
180
pdb_id a1 identity[%]2 description
2hsx A 86.1 R1AB_CVHSA Leader protein; p65 homolog; NSP1 (EC 3.4.22.-)
6zlw JA 100.0 R1AB_SARS2 Non-structural protein 1
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6zp4[8] C RS2_HUMAN 40S ribosomal protein S2[216 aa] BB 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 1
6zm7[7] ZA RS3_HUMAN 40S ribosomal protein S3[227 aa] HC 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 1
6zon[1] S RS30_HUMAN 40S ribosomal protein S30[44 aa] VA 100.0
/100.0
1
/1
R1AB_SARS2 Host translation inhibitor Nsp1
6zm7[5] CC RS30_HUMAN 40S ribosomal protein S30[58 aa] HC 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 1
6zlw[1] DA RS30_HUMAN 40S ribosomal protein S30[52 aa] JA 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6zlw[1] IA 18S ribosomal RNA JA 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 1
6zoj[1] A 18S ribosomal RNA IA 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 1
6zn5[1] HA 18S ribosomal RNA IA 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 1
6zm7[2] WA 18S ribosomal RNA HC 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 1
6zok[1] A 18S ribosomal RNA U 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 1
6zon[2] T 18S ribosomal RNA VA 100.0
/100.0
8
/8
R1AB_SARS2 Host translation inhibitor Nsp1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.