[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
46553 180 2 YP_009725297.1(YP_009725297.1) RecName: Full=leader protein
QUERYSEQ
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELG
TDPYEDFQENWNTKHSSGVTRELMRELNGG
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725297.1(YP_009725297.1)]

180
region name description
1-180 DISORDER predicted by DISOPRED (1-4,180-180)

MONOMER
180
pdb_id a1 identity[%]2 description
2gdt A 86.1 R1AB_CVHSA Leader protein; p65 homolog; NSP1 (EC 3.4.22.-)
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.