#WARNING:no index is registered index 'YP_009725299.1' in 'http://www.uniprot.org/uniprot/'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
34991 1945 206 YP_009725299.1()
QUERYSEQ
APTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAA
LQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVV
GPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSA
TLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDY
GARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTI
KVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYC
NKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFY
KENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKP
VETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNY
MPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDL
TAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDE
VARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEA
ELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725299.1()]

1945
region name description
1-1945 DISORDER predicted by DISOPRED (1-3,111-137,139-209,378-414,1066-1066,1211-1233,1235-1236,1239-1239,1822-1833,1931-1931,1935-1945)

MONOMER
1945
pdb_id a1 identity[%]2 description
6wuu A 99.7 R1AB_SARS2 papain-like protease
2w2g A 76.3 R1A_CVHSA NON-STRUCTURAL PROTEIN 3
6wey A 100.0 R1AB_SARS2 Non-structural protein 3
2k87 A 81.7 R1A_CVHSA Non-structural protein 3 of Replicase polyprotein 1a
2gri A 79.3 R1AB_CVHSA NSP3
2kaf A 77.4 R1A_CVHSA Non-structural protein 3
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6wx4[5] B VIR251[5 aa] A 100.0
/99.7
16
/16
R1AB_SARS2 Non-structural protein 3
6yva[1] B ISG15_MOUSE Ubiquitin-like protein ISG15[155 aa] A 96.6
/99.6
29
/29
R1A_SARS2 Replicase polyprotein 1a
5w8t[4] C ISG15_HUMAN Ubiquitin-like protein ISG15[77 aa] D 34.6
/31.4
26
/26
K0BWD0_9BETC ORF1ab
6xa9[5] B ISG15_HUMAN ISG15 CTD-propargylamide[80 aa] A 100.0
/100.0
22
/22
R1AB_SARS2 Papain-like protease
5tl7[2] C ISG15_MOUSE Ubiquitin-like protein ISG15[77 aa] D 91.7
/82.7
24
/24
R1AB_CVHSA Replicase polyprotein 1ab
6bi8[2] D ISG15_HUMAN Ubiquitin-like protein ISG15[153 aa] B 39.3
/31.5
28
/28
K4LC41_9BETC ORF1a
5v69[2] B ME.4[72 aa] A 30.4
/31.4
23
/23
K0BWD0_9BETC MERS-CoV PLpro
5e6j[2] F UBB_HUMAN Polyubiquitin-B[75 aa] D 70.0
/82.7
10
/10
R1AB_CVHSA Replicase polyprotein 1ab
4m0w[7] B RS27A_BOVIN Ubiquitin[76 aa] A 88.5
/82.3
26
/26
R1A_CVHSA Replicase polyprotein 1a
5bz0[3] B RS27A_BOVIN Ubiquitin-40S ribosomal protein S27a[76 aa] A 23.8
/25.3
21
/33
R1AB_IBVB Replicase polyprotein 1ab
4wur[1] B UBB_HUMAN Polyubiquitin-B[74 aa] A 39.1
/31.1
23
/23
R1AB_CVEMC Papain-like protease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4m0w[1] F NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 83.3
/82.3
6
/6
R1A_CVHSA Replicase polyprotein 1a
4m0w[1] E NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 85.7
/82.3
7
/7
R1A_CVHSA Replicase polyprotein 1a
6vxs[2] D NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
7jiv[2] B VBY
5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
7jn2[1] B Y41
3-amino-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]..
A 100.0
/100.0
10
/10
R1A_SARS2 Papain-Like Protease
7jit[1] B Y95
5-[(carbamoylcarbamoyl)amino]-2-methyl-N-[(1R)-1-(..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
7jir[2] B TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
4ow0[2] I S88
N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-..
B 100.0
/81.1
10
/10
R1A_CVHSA papain-like protease
4ovz[2] G P85
N-[(4-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-..
B 100.0
/81.3
11
/11
R1A_CVHSA Papain-like proteinase
3mj5[2] C GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale..
A 100.0
/82.7
9
/9
R1A_CVHSA Replicase polyprotein 1a
3mj5[2] E GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale..
A 100.0
/82.7
4
/4
R1A_CVHSA Replicase polyprotein 1a
5zub[3] B NAD
NICOTINAMIDE-ADENINE-DINUCLEOTIDE[44 atoms]
A 77.3
/44.4
22
/22
T2B9G2_9BETC ORF1a
6men[2] C ADQ
ADENOSINE-5'-DIPHOSPHATE-GLUCOSE[38 atoms]
A 84.2
/48.8
19
/21
R1AB_BCHK4 Replicase polyprotein 1ab
4d86[1] B ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 50.0
/36.3
10
/12
PAR14_HUMAN Poly [ADP-ribose] polymerase 14
5zu9[1] B ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 66.7
/44.4
15
/15
T2B9G2_9BETC ORF1a
5zua[1] B ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms]
A 61.5
/44.4
13
/13
T2B9G2_9BETC ORF1a
6w6y[1] C AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 100.0
/100.0
16
/16
R1AB_SARS2 SARS-CoV-2 NSP3
5zu7[1] B AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 61.5
/44.4
13
/13
T2B9G2_9BETC ORF1a
3gqe[1] C BCN
BICINE[11 atoms]
A 87.5
/40.4
8
/8
POLN_EEVVP Non-structural protein 3
5cb5[2] UA ZOD
[(2R,3R,4R,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin..
N 52.4
/34.0
21
/21
YMDB_ECOLI O-acetyl-ADP-ribose deacetylase
6woj[57] H APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
D 100.0
/100.0
23
/23
R1AB_SARS2 Non-structural protein 3
3gqo[5] F APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
B 77.8
/40.4
18
/22
POLN_EEVVP Non-structural protein 3
3q6z[1] B APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
A 55.6
/34.5
18
/18
PAR14_HUMAN Poly [ADP-ribose] polymerase 14
3ew5[3] K 1GP
SN-GLYCEROL-1-PHOSPHATE[10 atoms]
B 80.0
/33.1
10
/10
R1AB_FIPV macro domain of Non-structural protein 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7jn2[2] N UNX
UNKNOWN ATOM OR ION[1 atoms]
A 100.0
/100.0
1
/1
R1A_SARS2 Papain-Like Protease
6wuu[1] P MG
MAGNESIUM ION[1 atoms]
D 100.0
/99.7
2
/2
R1AB_SARS2 papain-like protease
6ywm[1] O MG
MAGNESIUM ION[1 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 NSP3 macrodomain
6wuu[1] K MG
MAGNESIUM ION[1 atoms]
B 100.0
/99.4
1
/1
R1AB_SARS2 papain-like protease
6ywl[2] Q MG
MAGNESIUM ION[1 atoms]
C 100.0
/100.0
1
/4
R1AB_SARS2 NSP3 macrodomain
6wuu[1] M MG
MAGNESIUM ION[1 atoms]
C 100.0
/99.7
1
/1
R1AB_SARS2 papain-like protease
6wuu[1] O MG
MAGNESIUM ION[1 atoms]
D 100.0
/99.7
5
/5
R1AB_SARS2 papain-like protease
7jit[4] D ZN
ZINC ION[1 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
7jit[5] F ZN
ZINC ION[1 atoms]
A 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
3mj5[45] F ZN
ZINC ION[1 atoms]
B 66.7
/81.3
6
/6
R1A_CVHSA Replicase polyprotein 1a
4wur[5] E ZN
ZINC ION[1 atoms]
A 80.0
/31.1
5
/5
R1AB_CVEMC Papain-like protease
5w8u[9] E ZN
ZINC ION[1 atoms]
A 100.0
/31.4
4
/4
K0BWD0_9BETC ORF1ab
5wfi[2] N ZN
ZINC ION[1 atoms]
B 100.0
/31.1
4
/4
R1AB_CVMA5 papain-like protease
4ypt[6] B ZN
ZINC ION[1 atoms]
A 100.0
/31.2
4
/4
R1AB_CVMA5 Replicase polyprotein 1ab
7jit[5] E ZN
ZINC ION[1 atoms]
A 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
5w8u[6] F ZN
ZINC ION[1 atoms]
A 0.0
/31.4
4
/4
K0BWD0_9BETC ORF1ab
7jn2[2] G ZN
ZINC ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-Like Protease
5ko3[1] B ZN
ZINC ION[1 atoms]
A 80.0
/31.0
5
/5
A0A023J538_9BETC ORF1a
5bz0[1] C ZN
ZINC ION[1 atoms]
A 75.0
/25.3
4
/4
R1AB_IBVB Replicase polyprotein 1ab
5w8t[2] G ZN
ZINC ION[1 atoms]
B 0.0
/31.4
1
/1
K0BWD0_9BETC ORF1ab
6bi8[2] L ZN
ZINC ION[1 atoms]
B 100.0
/31.5
4
/4
K4LC41_9BETC ORF1a
3mp2[1] B ZN
ZINC ION[1 atoms]
A 60.0
/30.1
5
/5
R1A_CVPPU Non-structural protein 3
4x2z[1] B ZN
ZINC ION[1 atoms]
A 75.0
/25.0
4
/4
R1AB_IBVB Nonstructural protein 3
2fe8[6] J BR
BROMIDE ION[1 atoms]
B 75.0
/82.7
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] P BR
BROMIDE ION[1 atoms]
C 100.0
/82.7
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] L BR
BROMIDE ION[1 atoms]
B 100.0
/82.7
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
5e6j[1] H NI
NICKEL (II) ION[1 atoms]
A 0.0
/82.0
2
/2
R1AB_CVHSA Replicase polyprotein 1ab
5y3q[2] H NA
SODIUM ION[1 atoms]
A 100.0
/82.8
7
/7
R1A_CVHSA Replicase polyprotein 1a
5y3q[2] F NA
SODIUM ION[1 atoms]
A 83.3
/82.8
6
/6
R1A_CVHSA Replicase polyprotein 1a
5y3q[3] D NA
SODIUM ION[1 atoms]
A 100.0
/82.8
4
/4
R1A_CVHSA Replicase polyprotein 1a
4m0w[1] D NA
SODIUM ION[1 atoms]
A 20.0
/82.3
5
/5
R1A_CVHSA Replicase polyprotein 1a
5y3e[2] D NA
SODIUM ION[1 atoms]
A 40.0
/82.8
5
/5
R1A_CVHSA Replicase polyprotein 1a
5y3e[2] F NA
SODIUM ION[1 atoms]
A 100.0
/82.8
3
/3
R1A_CVHSA Replicase polyprotein 1a
3jzt[1] K NA
SODIUM ION[1 atoms]
B 0.0
/33.1
2
/2
R1AB_FIPV macro domain of Non-structural protein 3
7jir[10] I CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
7jir[8] G CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
6
/6
R1A_SARS2 Papain-like protease
6w9c[3] F CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
6
/6
R1A_SARS2 Papain-like proteinase
3ew5[2] I CL
CHLORIDE ION[1 atoms]
B 100.0
/33.1
1
/1
R1AB_FIPV macro domain of Non-structural protein 3
3ew5[2] N CL
CHLORIDE ION[1 atoms]
C 0.0
/33.1
1
/1
R1AB_FIPV macro domain of Non-structural protein 3
7jiw[3] J CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-Like Protease
6wrh[3] F CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
3
/3
R1AB_SARS2 Non-structural protein 3
3e9s[1] E CL
CHLORIDE ION[1 atoms]
A 75.0
/82.7
4
/4
R1A_CVHSA Non-structural protein 3
5v6a[1] G CL
CHLORIDE ION[1 atoms]
A 0.0
/31.4
4
/4
K0BWD0_9BETC MERS-CoV PLpro
3jzt[1] I CL
CHLORIDE ION[1 atoms]
A 0.0
/33.1
1
/1
R1AB_FIPV macro domain of Non-structural protein 3
5v6a[1] F CL
CHLORIDE ION[1 atoms]
A 100.0
/31.4
2
/2
K0BWD0_9BETC MERS-CoV PLpro
6wen[1] B CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6w9c[6] B R1A_SARS2 Papain-like proteinase[306 aa] A 100.0
/100.0
5
/5
R1A_SARS2 Papain-like proteinase
6xg3[2] A R1AB_SARS2 Peptidase C16[313 aa] A 100.0
/99.7
24
/24
R1AB_SARS2 Peptidase C16
2fe8[6] A R1AB_CVHSA Replicase polyprotein 1ab[315 aa] C 87.5
/82.7
16
/16
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] C R1AB_CVHSA Replicase polyprotein 1ab[313 aa] C 75.0
/82.7
8
/9
R1AB_CVHSA Replicase polyprotein 1ab
3mj5[8] B R1A_CVHSA Replicase polyprotein 1a[262 aa] A 72.0
/82.7
25
/25
R1A_CVHSA Replicase polyprotein 1a
2wct[6] C R1A_CVHSA NON-STRUCTURAL PROTEIN 3[252 aa] B 79.2
/76.3
24
/24
R1A_CVHSA NON-STRUCTURAL PROTEIN 3
3ewp[2] B R1A_IBVM Non-structural protein 3[168 aa] A 0.0
/31.9
11
/16
R1A_IBVM Non-structural protein 3
3ewp[2] A R1A_IBVM Non-structural protein 3[177 aa] B 12.5
/31.9
16
/16
R1A_IBVM Non-structural protein 3
4pt5[4] A K4LC41_9BETC Papain-like protease[321 aa] A 26.5
/31.3
34
/34
K4LC41_9BETC Papain-like protease
4p16[2] A K4LC41_9BETC ORF1a[315 aa] A 28.6
/31.5
28
/28
K4LC41_9BETC ORF1a
4ypt[3] A R1AB_CVMA5 Replicase polyprotein 1ab[378 aa] A 22.2
/31.2
18
/20
R1AB_CVMA5 Replicase polyprotein 1ab
4ypt[3] A R1AB_CVMA5 Replicase polyprotein 1ab[378 aa] A 50.0
/31.2
22
/22
R1AB_CVMA5 Replicase polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6ywk[8] AA EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
4
/4
R1AB_SARS2 NSP3 macrodomain
6ywk[6] FA EDO
1,2-ETHANEDIOL[4 atoms]
E 100.0
/100.0
7
/7
R1AB_SARS2 NSP3 macrodomain
6bi8[10] R EDO
1,2-ETHANEDIOL[4 atoms]
B 66.7
/31.5
3
/3
K4LC41_9BETC ORF1a
6ywl[5] N EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 NSP3 macrodomain
6ywl[2] O EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 NSP3 macrodomain
6ywl[2] U EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
5
/5
R1AB_SARS2 NSP3 macrodomain
6ywm[2] L EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 NSP3 macrodomain
6ywl[3] R EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 NSP3 macrodomain
6ywk[1] Z EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
1
/1
R1AB_SARS2 NSP3 macrodomain
6ywk[1] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 NSP3 macrodomain
6ywm[5] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 NSP3 macrodomain
6ywm[1] I EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 NSP3 macrodomain
6ywl[3] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 NSP3 macrodomain
6ywk[1] W EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
1
/1
R1AB_SARS2 NSP3 macrodomain
6ywk[1] EA EDO
1,2-ETHANEDIOL[4 atoms]
E 100.0
/100.0
5
/5
R1AB_SARS2 NSP3 macrodomain
6ywk[2] M EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 NSP3 macrodomain
6ywk[1] L EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
2
/3
R1AB_SARS2 NSP3 macrodomain
7jit[3] J MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
6ywm[4] N MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
C 100.0
/100.0
9
/9
R1AB_SARS2 NSP3 macrodomain
6wcf[1] C MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
1spv[1] B MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 63.6
/34.0
11
/11
YMDB_ECOLI putative polyprotein/phosphatase
7jiw[1] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
6
/6
R1A_SARS2 Papain-Like Protease
6ywk[1] CA EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
E 100.0
/100.0
11
/11
R1AB_SARS2 NSP3 macrodomain
6ywk[2] DA EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
E 100.0
/100.0
6
/6
R1AB_SARS2 NSP3 macrodomain
7jit[1] L ACT
ACETATE ION[4 atoms]
A 100.0
/99.7
5
/5
R1A_SARS2 Papain-like protease
7jn2[1] L ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-Like Protease
7jit[3] K ACT
ACETATE ION[4 atoms]
A 85.7
/99.7
7
/7
R1A_SARS2 Papain-like protease
5cb5[2] CB ACT
ACETATE ION[4 atoms]
R 0.0
/34.0
3
/3
YMDB_ECOLI O-acetyl-ADP-ribose deacetylase
5ko3[1] F ACT
ACETATE ION[4 atoms]
A 40.0
/31.0
5
/5
A0A023J538_9BETC ORF1a
5ko3[1] D ACT
ACETATE ION[4 atoms]
A 20.0
/31.0
5
/5
A0A023J538_9BETC ORF1a
5ko3[1] H ACT
ACETATE ION[4 atoms]
A 0.0
/31.0
3
/4
A0A023J538_9BETC ORF1a
5ko3[1] C ACT
ACETATE ION[4 atoms]
A 0.0
/31.0
2
/2
A0A023J538_9BETC ORF1a
5ko3[1] G ACT
ACETATE ION[4 atoms]
A 33.3
/31.0
3
/4
A0A023J538_9BETC ORF1a
5e6j[1] G ACT
ACETATE ION[4 atoms]
A 83.3
/82.0
6
/6
R1AB_CVHSA Replicase polyprotein 1ab
5ko3[1] E ACT
ACETATE ION[4 atoms]
A 100.0
/31.0
2
/2
A0A023J538_9BETC ORF1a
5ko3[1] I ACT
ACETATE ION[4 atoms]
A 85.7
/31.0
7
/7
A0A023J538_9BETC ORF1a
5cb5[1] PA ACT
ACETATE ION[4 atoms]
K 50.0
/34.0
2
/2
YMDB_ECOLI O-acetyl-ADP-ribose deacetylase
5y3q[1] C BME
BETA-MERCAPTOETHANOL[4 atoms]
A 100.0
/82.8
6
/6
R1A_CVHSA Replicase polyprotein 1a
4ow0[1] J DMS
DIMETHYL SULFOXIDE[4 atoms]
B 50.0
/81.1
2
/2
R1A_CVHSA papain-like protease
4ovz[1] I DMS
DIMETHYL SULFOXIDE[4 atoms]
B 33.3
/81.3
3
/3
R1A_CVHSA Papain-like proteinase
4ovz[3] K DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/81.3
4
/4
R1A_CVHSA Papain-like proteinase
4ovz[1] L DMS
DIMETHYL SULFOXIDE[4 atoms]
B 66.7
/81.3
6
/6
R1A_CVHSA Papain-like proteinase
4ovz[1] J DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/81.3
3
/3
R1A_CVHSA Papain-like proteinase
4ow0[1] G DMS
DIMETHYL SULFOXIDE[4 atoms]
A 60.0
/82.6
5
/5
R1A_CVHSA papain-like protease
5wfi[6] L GOL
GLYCEROL[6 atoms]
B 0.0
/31.1
2
/2
R1AB_CVMA5 papain-like protease
4ypt[6] G GOL
GLYCEROL[6 atoms]
A 0.0
/31.2
5
/5
R1AB_CVMA5 Replicase polyprotein 1ab
4ypt[3] E GOL
GLYCEROL[6 atoms]
A 28.6
/31.2
7
/7
R1AB_CVMA5 Replicase polyprotein 1ab
5wfi[2] J GOL
GLYCEROL[6 atoms]
B 0.0
/31.1
7
/7
R1AB_CVMA5 papain-like protease
2acf[1] J GOL
GLYCEROL[6 atoms]
C 100.0
/72.9
7
/7
Replicase polyprotein 1ab
2acf[1] F GOL
GLYCEROL[6 atoms]
A 80.0
/73.4
5
/5
Replicase polyprotein 1ab
4ypt[3] F GOL
GLYCEROL[6 atoms]
A 25.0
/31.2
4
/4
R1AB_CVMA5 Replicase polyprotein 1ab
4ypt[3] D GOL
GLYCEROL[6 atoms]
A 0.0
/31.2
2
/2
R1AB_CVMA5 Replicase polyprotein 1ab
4ypt[3] D GOL
GLYCEROL[6 atoms]
A 50.0
/31.2
4
/4
R1AB_CVMA5 Replicase polyprotein 1ab
5y3q[2] J GOL
GLYCEROL[6 atoms]
A 100.0
/82.8
6
/6
R1A_CVHSA Replicase polyprotein 1a
6bi8[1] M GOL
GLYCEROL[6 atoms]
B 75.0
/31.5
4
/4
K4LC41_9BETC ORF1a
6bi8[1] O GOL
GLYCEROL[6 atoms]
B 20.0
/31.5
5
/5
K4LC41_9BETC ORF1a
5wfi[2] K GOL
GLYCEROL[6 atoms]
B 37.5
/31.1
8
/8
R1AB_CVMA5 papain-like protease
2acf[1] O GOL
GLYCEROL[6 atoms]
C 75.0
/72.9
4
/4
Replicase polyprotein 1ab
2acf[1] K GOL
GLYCEROL[6 atoms]
C 100.0
/72.9
4
/4
Replicase polyprotein 1ab
2acf[1] L GOL
GLYCEROL[6 atoms]
C 50.0
/72.9
2
/2
Replicase polyprotein 1ab
4m0w[6] G GOL
GLYCEROL[6 atoms]
A 100.0
/82.3
5
/5
R1A_CVHSA Replicase polyprotein 1a
5dus[3] G GOL
GLYCEROL[6 atoms]
A 0.0
/44.4
3
/3
T2B9G2_9BETC ORF1a
4ow0[1] F GOL
GLYCEROL[6 atoms]
A 66.7
/82.6
3
/3
R1A_CVHSA papain-like protease
4ypt[3] C GOL
GLYCEROL[6 atoms]
A 50.0
/31.2
8
/8
R1AB_CVMA5 Replicase polyprotein 1ab
6bi8[1] G GOL
GLYCEROL[6 atoms]
A 66.7
/31.5
3
/3
K4LC41_9BETC ORF1a
6wrh[2] I GOL
GLYCEROL[6 atoms]
A 100.0
/99.7
6
/6
R1AB_SARS2 Non-structural protein 3
5dus[1] F GOL
GLYCEROL[6 atoms]
A 25.0
/44.4
4
/4
T2B9G2_9BETC ORF1a
5wfi[1] G GOL
GLYCEROL[6 atoms]
A 0.0
/31.1
3
/3
R1AB_CVMA5 papain-like protease
6xa9[3] K GOL
GLYCEROL[6 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 Papain-like protease
5wfi[2] O GOL
GLYCEROL[6 atoms]
A 0.0
/31.1
1
/1
R1AB_CVMA5 papain-like protease
6wrh[2] H GOL
GLYCEROL[6 atoms]
A 100.0
/99.7
3
/3
R1AB_SARS2 Non-structural protein 3
5y3e[1] J GOL
GLYCEROL[6 atoms]
A 100.0
/82.8
5
/5
R1A_CVHSA Replicase polyprotein 1a
2acf[1] N GOL
GLYCEROL[6 atoms]
C 50.0
/72.9
2
/2
Replicase polyprotein 1ab
5cms[25] NA SO4
SULFATE ION[5 atoms]
K 0.0
/34.0
1
/5
C3TEL7_ECOLX O-acetyl-ADP-ribose deacetylase
2w2g[2] D SO4
SULFATE ION[5 atoms]
B 33.3
/75.0
3
/3
R1A_CVHSA NON-STRUCTURAL PROTEIN 3
4rf0[1] I SO4
SULFATE ION[5 atoms]
A 0.0
/31.4
4
/4
M4STU1_9BETC ORF1ab protein
2fe8[6] R SO4
SULFATE ION[5 atoms]
C 100.0
/82.7
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
4rf0[1] D SO4
SULFATE ION[5 atoms]
A 100.0
/31.4
2
/2
M4STU1_9BETC ORF1ab protein
4rf0[1] F SO4
SULFATE ION[5 atoms]
A 33.3
/31.4
6
/6
M4STU1_9BETC ORF1ab protein
4rf0[1] J SO4
SULFATE ION[5 atoms]
A 25.0
/31.4
4
/4
M4STU1_9BETC ORF1ab protein
4rf0[2] L SO4
SULFATE ION[5 atoms]
A 0.0
/31.4
2
/2
M4STU1_9BETC ORF1ab protein
5dus[1] E SO4
SULFATE ION[5 atoms]
A 66.7
/44.4
3
/3
T2B9G2_9BETC ORF1a
5dus[1] C SO4
SULFATE ION[5 atoms]
A 0.0
/44.4
1
/1
T2B9G2_9BETC ORF1a
4rf0[1] H SO4
SULFATE ION[5 atoms]
A 0.0
/31.4
5
/5
M4STU1_9BETC ORF1ab protein
4rf0[1] E SO4
SULFATE ION[5 atoms]
A 25.0
/31.4
4
/4
M4STU1_9BETC ORF1ab protein
3ew5[2] L SO4
SULFATE ION[5 atoms]
C 0.0
/33.1
2
/2
R1AB_FIPV macro domain of Non-structural protein 3
6vxs[2] E SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
3ew5[2] M SO4
SULFATE ION[5 atoms]
C 100.0
/33.1
1
/2
R1AB_FIPV macro domain of Non-structural protein 3
6vxs[2] C SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
3ew5[2] O SO4
SULFATE ION[5 atoms]
C 0.0
/33.1
1
/1
R1AB_FIPV macro domain of Non-structural protein 3
3ew5[1] E SO4
SULFATE ION[5 atoms]
A 0.0
/33.1
3
/3
R1AB_FIPV macro domain of Non-structural protein 3
5tl6[1] F SO4
SULFATE ION[5 atoms]
A 100.0
/82.9
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
3eke[1] B TLA
L(+)-TARTARIC ACID[10 atoms]
A 0.0
/31.9
4
/4
R1AB_IBVB Non-structural protein 3
3eke[1] C TLA
L(+)-TARTARIC ACID[10 atoms]
A 66.7
/31.9
6
/6
R1AB_IBVB Non-structural protein 3
4rf0[2] K 3CN
3-AMINOPROPANE[4 atoms]
A 80.0
/31.4
5
/5
M4STU1_9BETC ORF1ab protein
5v69[1] F PGO
S-1,2-PROPANEDIOL[5 atoms]
A 33.3
/31.4
3
/3
K0BWD0_9BETC MERS-CoV PLpro
4rez[2] D PGO
S-1,2-PROPANEDIOL[5 atoms]
A 28.6
/31.9
7
/7
M4STU1_9BETC ORF1ab protein
5v69[1] G PGO
S-1,2-PROPANEDIOL[5 atoms]
A 75.0
/31.4
8
/8
K0BWD0_9BETC MERS-CoV PLpro
4rez[3] E PGO
S-1,2-PROPANEDIOL[5 atoms]
A 25.0
/31.9
4
/4
M4STU1_9BETC ORF1ab protein
4rez[1] C PGO
S-1,2-PROPANEDIOL[5 atoms]
A 20.0
/31.9
5
/5
M4STU1_9BETC ORF1ab protein
4rf1[1] E PGO
S-1,2-PROPANEDIOL[5 atoms]
A 50.0
/31.6
6
/6
M4STU1_9BETC ORF1ab protein
4rf1[1] H PGO
S-1,2-PROPANEDIOL[5 atoms]
A 0.0
/31.6
2
/2
M4STU1_9BETC ORF1ab protein
6bi8[1] P CIT
CITRIC ACID[13 atoms]
B 50.0
/31.5
2
/2
K4LC41_9BETC ORF1a
6bi8[1] K PGE
TRIETHYLENE GLYCOL[10 atoms]
B 33.3
/31.5
3
/3
K4LC41_9BETC ORF1a
6bi8[2] T PGE
TRIETHYLENE GLYCOL[10 atoms]
A 0.0
/31.5
4
/4
K4LC41_9BETC ORF1a
6bi8[1] E PGE
TRIETHYLENE GLYCOL[10 atoms]
A 60.0
/31.5
5
/5
K4LC41_9BETC ORF1a
5w8t[3] Q MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
D 50.0
/31.4
4
/4
K0BWD0_9BETC ORF1ab
5w8u[4] J MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 0.0
/31.4
3
/3
K0BWD0_9BETC ORF1ab
5w8u[2] K MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 0.0
/31.4
3
/4
K0BWD0_9BETC ORF1ab
5w8u[4] Q MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
C 50.0
/31.4
4
/4
K0BWD0_9BETC ORF1ab
5w8t[1] O MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
D 33.3
/31.4
3
/3
K0BWD0_9BETC ORF1ab
5w8u[4] H AYE
prop-2-en-1-amine[4 atoms]
A 66.7
/31.4
6
/6
K0BWD0_9BETC ORF1ab
6bi8[2] S AYE
prop-2-en-1-amine[4 atoms]
B 66.7
/31.5
6
/6
K4LC41_9BETC ORF1a
5v6a[1] E FLC
CITRATE ANION[13 atoms]
A 0.0
/31.4
1
/1
K0BWD0_9BETC MERS-CoV PLpro
5v6a[1] D FLC
CITRATE ANION[13 atoms]
A 25.0
/31.4
4
/5
K0BWD0_9BETC MERS-CoV PLpro
4rna[4] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/31.3
1
/1
K4LC41_9BETC papain-like protease
4rna[2] F PO4
PHOSPHATE ION[5 atoms]
A 50.0
/31.3
2
/2
K4LC41_9BETC papain-like protease
6xg3[3] C PO4
PHOSPHATE ION[5 atoms]
A 83.3
/99.7
6
/6
R1AB_SARS2 Peptidase C16
6wrh[2] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
4rna[2] E PO4
PHOSPHATE ION[5 atoms]
A 28.6
/31.3
7
/7
K4LC41_9BETC papain-like protease
6wzu[2] E PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
4rna[2] C PO4
PHOSPHATE ION[5 atoms]
A 14.3
/31.3
7
/7
K4LC41_9BETC papain-like protease
4rna[2] D PO4
PHOSPHATE ION[5 atoms]
A 16.7
/31.3
6
/6
K4LC41_9BETC papain-like protease
5wfi[1] M FMT
FORMIC ACID[3 atoms]
B 0.0
/31.1
1
/1
R1AB_CVMA5 papain-like protease
5wfi[1] H FMT
FORMIC ACID[3 atoms]
A 25.0
/31.1
4
/4
R1AB_CVMA5 papain-like protease
4wur[1] C IPA
ISOPROPYL ALCOHOL[4 atoms]
A 16.7
/31.1
6
/6
R1AB_CVEMC Papain-like protease
4wur[1] D IPA
ISOPROPYL ALCOHOL[4 atoms]
A 33.3
/31.1
3
/3
R1AB_CVEMC Papain-like protease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.