#WARNING:no index is registered index 'YP_009725304.1' in 'http://www.uniprot.org/uniprot/'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
56096 198 45 YP_009725304.1()
QUERYSEQ
AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYA
SALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725304.1()]

198
region name description
1-198 DISORDER predicted by DISOPRED (1-4,197-198)

MONOMER
198
pdb_id a1 identity[%]2 description
2ahm H 97.4 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
198 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6yyt[31] C R1AB_SARS2 nsp7[73 aa] D 100.0
/100.0
24
/24
R1AB_SARS2 nsp8
2ahm[4] B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] F 100.0
/97.2
3
/3
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
6wqd[11] A R1AB_SARS2 SARS-CoV-2 NSP7[74 aa] B 100.0
/100.0
25
/25
R1AB_SARS2 SARS-CoV-2 NSP8
7bw4[11] C R1AB_SARS2 Replicase polyprotein 1ab[65 aa] B 100.0
/100.0
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
7jlt[2] C R1AB_SARS2 Non-structural protein 7[81 aa] B 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 8
2ahm[4] B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] H 100.0
/97.4
3
/3
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[4] D R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] G 100.0
/97.4
8
/8
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
6wiq[8] A R1AB_SARS2 SARS-CoV-2 NSP7[80 aa] B 100.0
/100.0
8
/8
R1AB_SARS2 SARS-CoV-2 NSP8
6yyt[1] C R1AB_SARS2 nsp7[73 aa] B 100.0
/100.0
3
/3
R1AB_SARS2 nsp8
6xez[2] E R1AB_SARS2 nsp13[596 aa] D 100.0
/100.0
6
/6
R1AB_SARS2 nsp8
6xqb[2] A R1AB_SARS2 RNA-directed RNA polymerase[801 aa] D 100.0
/100.0
1
/1
R1AB_SARS2 Non-structural protein 8
7aap[6] A R1AB_SARS2 Non-structural protein 12[911 aa] F 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 8
7aap[13] A R1AB_SARS2 Non-structural protein 12[911 aa] B 100.0
/100.0
42
/42
R1AB_SARS2 Non-structural protein 8
6xez[1] A R1AB_SARS2 nsp12[926 aa] D 100.0
/100.0
11
/11
R1AB_SARS2 nsp8
6yyt[2] A R1AB_SARS2 nsp12[853 aa] D 100.0
/100.0
10
/10
R1AB_SARS2 nsp8
6nus[1] A R1AB_CVHSA NSP12[715 aa] B 100.0
/96.4
40
/40
R1A_CVHSA NSP8
3ub0[2] F R1AB_FIPV Non-structural protein 7, nsp7[78 aa] D 55.2
/43.2
29
/29
R1AB_FIPV Non-structural protein 6, nsp6,
3ub0[2] B R1AB_FIPV Non-structural protein 7, nsp7[82 aa] A 33.3
/42.7
12
/12
R1AB_FIPV Non-structural protein 6, nsp6,
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
198 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6yyt[4] F RNA product D 100.0
/100.0
3
/3
R1AB_SARS2 nsp8
7c2k[1] E RNA (29-MER) D 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 8
6yyt[1] G RNA product D 100.0
/100.0
3
/3
R1AB_SARS2 nsp8
6xez[2] G Product RNA B 100.0
/100.0
2
/2
R1AB_SARS2 nsp8
6xez[2] H Template RNA B 100.0
/100.0
2
/2
R1AB_SARS2 nsp8
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
198 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2ahm[12] E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] E 100.0
/97.4
19
/19
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[4] F R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] H 100.0
/97.4
7
/7
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[6] F R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] H 100.0
/97.4
7
/7
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[4] G R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] E 100.0
/97.4
8
/8
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[2] E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] H 100.0
/97.4
7
/7
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
198 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6wtc[1] F ACY
ACETIC ACID[4 atoms]
D 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP8
6wtc[1] E ACY
ACETIC ACID[4 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP8
6wqd[3] G EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP8
6xip[1] F EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 8
6wqd[2] F EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP8
2ahm[2] N SO4
SULFATE ION[5 atoms]
H 75.0
/97.4
4
/4
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[4] M GOL
GLYCEROL[6 atoms]
F 100.0
/97.2
3
/3
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[6] K GOL
GLYCEROL[6 atoms]
E 100.0
/97.4
2
/2
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm[6] K GOL
GLYCEROL[6 atoms]
E 100.0
/97.4
1
/1
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.