[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
58077 113 24 YP_009725305.1(YP_009725305.1) RecName: Full=nsp9
QUERYSEQ
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725305.1(YP_009725305.1)]

113
region name description
1-8 DISORDER predicted by DISOPRED (1-2,8-8)

MONOMER
113
pdb_id a1 identity[%]2 description
6w4b B 100.0 Nsp9 replicase protein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2j98[2] B R1A_CVH22 REPLICASE POLYPROTEIN 1AB[102 aa] A 66.7
/43.4
15
/15
R1A_CVH22 REPLICASE POLYPROTEIN 1AB
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1uw7[2] A R1AB_CVHSA NSP9[122 aa] A 100.0
/97.3
21
/24
R1AB_CVHSA NSP9
1qz8[10] B R1AB_CVHSA polyprotein 1ab[110 aa] A 100.0
/97.3
17
/17
R1AB_CVHSA polyprotein 1ab
1qz8[2] A R1AB_CVHSA polyprotein 1ab[111 aa] A 100.0
/97.3
6
/6
R1AB_CVHSA polyprotein 1ab
2j97[2] A R1A_CVH22 REPLICASE POLYPROTEIN 1AB[98 aa] A 86.4
/54.9
22
/22
R1A_CVH22 REPLICASE POLYPROTEIN 1AB
5hiz[6] A R1AB_PEDV7 Non-structural protein 9[96 aa] B 66.7
/50.0
9
/11
R1AB_PEDV7 Non-structural protein 9
5c94[2] A R1AB_IBVM Non-structural protein 9[116 aa] A 64.7
/39.6
17
/21
R1AB_IBVM Non-structural protein 9
5ym6[4] A X2G6C4_9NIDO nsp9[97 aa] B 70.0
/38.1
20
/21
X2G6C4_9NIDO nsp9
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2j97[4] D SO4
SULFATE ION[5 atoms]
A 100.0
/54.9
1
/2
R1A_CVH22 REPLICASE POLYPROTEIN 1AB
1qz8[4] D SO4
SULFATE ION[5 atoms]
A 100.0
/97.3
1
/1
R1AB_CVHSA polyprotein 1ab
1qz8[8] D SO4
SULFATE ION[5 atoms]
A 100.0
/97.3
1
/1
R1AB_CVHSA polyprotein 1ab
2j97[2] C SO4
SULFATE ION[5 atoms]
A 40.0
/54.9
5
/5
R1A_CVH22 REPLICASE POLYPROTEIN 1AB
1qz8[2] F SO4
SULFATE ION[5 atoms]
B 50.0
/97.3
2
/2
R1AB_CVHSA polyprotein 1ab
3ee7[2] N GOL
GLYCEROL[6 atoms]
B 100.0
/96.3
4
/4
R1A_CVHSA Replicase polyprotein 1a
3ee7[6] L GOL
GLYCEROL[6 atoms]
B 100.0
/96.3
1
/1
R1A_CVHSA Replicase polyprotein 1a
3ee7[1] T GOL
GLYCEROL[6 atoms]
C 100.0
/96.3
2
/2
R1A_CVHSA Replicase polyprotein 1a
3ee7[3] R GOL
GLYCEROL[6 atoms]
C 100.0
/96.3
2
/2
R1A_CVHSA Replicase polyprotein 1a
3ee7[1] O GOL
GLYCEROL[6 atoms]
B 100.0
/96.3
3
/3
R1A_CVHSA Replicase polyprotein 1a
3ee7[1] S GOL
GLYCEROL[6 atoms]
C 100.0
/96.3
4
/4
R1A_CVHSA Replicase polyprotein 1a
3ee7[5] BA GOL
GLYCEROL[6 atoms]
D 100.0
/96.3
2
/2
R1A_CVHSA Replicase polyprotein 1a
3ee7[1] Y GOL
GLYCEROL[6 atoms]
D 100.0
/96.3
3
/3
R1A_CVHSA Replicase polyprotein 1a
3ee7[1] X GOL
GLYCEROL[6 atoms]
D 100.0
/96.3
4
/4
R1A_CVHSA Replicase polyprotein 1a
3ee7[1] J GOL
GLYCEROL[6 atoms]
A 100.0
/96.2
6
/6
R1A_CVHSA Replicase polyprotein 1a
3ee7[5] U PO4
PHOSPHATE ION[5 atoms]
D 100.0
/96.3
1
/1
R1A_CVHSA Replicase polyprotein 1a
3ee7[4] W PO4
PHOSPHATE ION[5 atoms]
D 100.0
/96.3
1
/1
R1A_CVHSA Replicase polyprotein 1a
3ee7[1] M PO4
PHOSPHATE ION[5 atoms]
B 66.7
/96.3
3
/3
R1A_CVHSA Replicase polyprotein 1a
3ee7[1] P PO4
PHOSPHATE ION[5 atoms]
D 100.0
/96.3
1
/1
R1A_CVHSA Replicase polyprotein 1a
2j97[2] B MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 100.0
/54.9
4
/5
R1A_CVH22 REPLICASE POLYPROTEIN 1AB
2j98[1] C DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms]
A 50.0
/43.4
6
/6
R1A_CVH22 REPLICASE POLYPROTEIN 1AB
5c94[2] B PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 25.0
/39.6
4
/4
R1AB_IBVM Non-structural protein 9
5c94[2] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 80.0
/39.6
5
/5
R1AB_IBVM Non-structural protein 9
5c94[2] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 40.0
/39.6
5
/5
R1AB_IBVM Non-structural protein 9
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.