[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
51391 601 4 YP_009725308.1(YP_009725308.1) RecName: Full=helicase
QUERYSEQ
AVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYG
IATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYP
SARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVD
TVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATL
Q
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725308.1(YP_009725308.1)]

601
region name description
1-601 DISORDER predicted by DISOPRED (1-1,594-601)

MONOMER
601
pdb_id a1 identity[%]2 description
6jyt B 99.8 R1AB_CVHSA Helicase
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
METAL
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6jyt[4] C ZN
ZINC ION[1 atoms]
A 100.0
/99.8
4
/4
R1AB_CVHSA Helicase
5wwp[4] D ZN
ZINC ION[1 atoms]
A 100.0
/72.3
4
/4
K0BWD0_9BETC ORF1ab
6jyt[4] G ZN
ZINC ION[1 atoms]
B 100.0
/99.8
4
/4
R1AB_CVHSA Helicase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5wwp[1] K SO4
SULFATE ION[5 atoms]
B 100.0
/72.6
4
/4
K0BWD0_9BETC ORF1ab
5wwp[3] F SO4
SULFATE ION[5 atoms]
A 100.0
/72.3
5
/5
K0BWD0_9BETC ORF1ab
5wwp[1] J SO4
SULFATE ION[5 atoms]
B 100.0
/72.6
6
/6
K0BWD0_9BETC ORF1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.