#WARNING:no index is registered index 'YP_009725308.1' in 'http://www.uniprot.org/uniprot/'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
56988 601 110 YP_009725308.1()
QUERYSEQ
AVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYG
IATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYP
SARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVD
TVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATL
Q
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725308.1()]

601
region name description
1-601 DISORDER predicted by DISOPRED (1-1,594-601)

MONOMER
601
pdb_id a1 identity[%]2 description
6xez F 100.0 R1AB_SARS2 nsp13
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez[1] C R1AB_SARS2 nsp7[73 aa] E 100.0
/100.0
1
/1
R1AB_SARS2 nsp13
6xez[1] B R1AB_SARS2 nsp8[186 aa] F 100.0
/100.0
10
/10
R1AB_SARS2 nsp13
6xez[1] D R1AB_SARS2 nsp8[186 aa] E 100.0
/100.0
4
/4
R1AB_SARS2 nsp13
6xez[1] A R1AB_SARS2 nsp12[926 aa] E 100.0
/100.0
3
/3
R1AB_SARS2 nsp13
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5rly[1] J K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rly[1] I K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rly[1] C K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rme[1] C RYM
4-(benzimidazol-1-ylmethyl)benzenecarbonitrile[18 ..
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rm8[1] C GQJ
methyl (2~{S},4~{R})-1-(furan-2-ylcarbonyl)-4-oxid..
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rli[1] I JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rli[2] C JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rlj[1] H VW4
(2S)-2-phenylpropane-1-sulfonamide[13 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rlm[1] H VW7
N-(8-methyl-1,2,3,4-tetrahydroquinolin-5-yl)acetam..
B 100.0
/100.0
3
/3
R1AB_SARS2 Helicase
5rlk[1] H NYV
1-(propan-2-yl)-1H-imidazole-4-sulfonamide[12 atom..
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rlg[1] C VW1
(2S)-2-(4-cyanophenoxy)propanamide[14 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rll[1] H H04
1-(2-ethoxyphenyl)piperazine[15 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rlo[1] H UQS
N-[(2-fluorophenyl)methyl]-1H-pyrazol-4-amine[14 a..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rmg[1] H MUK
4,6-dimethyl-~{N}-phenyl-pyrimidin-2-amine[15 atom..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rmf[1] C NX7
(2,6-difluorophenyl)(pyrrolidin-1-yl)methanone[15 ..
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
6xez[1] U 1N7
CHAPSO[36 atoms]
E 100.0
/100.0
3
/3
R1AB_SARS2 nsp13
5rm4[1] H PK4
2-fluoro-N,3-dimethylbenzene-1-sulfonamide[13 atom..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rmj[1] C JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid..
A 100.0
/100.0
10
/10
R1AB_SARS2 Helicase
5rm6[1] H HR5
~{N}-(cyclobutylmethyl)-1,5-dimethyl-pyrazole-4-ca..
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rlh[1] H K2P
2-(trifluoromethoxy)benzoic acid[14 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rlc[1] H VVM
4-amino-N-phenylbenzene-1-sulfonamide[17 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rle[1] H VVP
4-methoxy-1H-indole[11 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rm2[1] H UXG
1-(diphenylmethyl)azetidin-3-ol[18 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rm2[1] I UXG
1-(diphenylmethyl)azetidin-3-ol[18 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rlt[1] H UVJ
3-(2-methyl-1H-benzimidazol-1-yl)propanamide[15 at..
B 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rl9[1] H UR7
1-(3-fluoro-4-methylphenyl)methanesulfonamide[13 a..
B 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rlb[1] C VVJ
N-cycloheptyl-N-methylmethanesulfonamide[13 atoms]..
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rl8[1] D VVG
N-(2-fluorophenyl)ethanesulfonamide[13 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rl8[1] C VVG
N-(2-fluorophenyl)ethanesulfonamide[13 atoms]
A 100.0
/100.0
10
/10
R1AB_SARS2 Helicase
5rmh[1] C VX4
[(4S)-4-methylazepan-1-yl](1,3-thiazol-4-yl)methan..
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rl7[1] I VVD
5-(acetylamino)-2-fluorobenzoic acid[14 atoms]
B 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rl7[1] C VVD
5-(acetylamino)-2-fluorobenzoic acid[14 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rlu[1] I JG4
2-(thiophen-2-yl)-1H-imidazole[10 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rlu[1] C JG4
2-(thiophen-2-yl)-1H-imidazole[10 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Helicase
5rm5[1] H NUA
N-(1-ethyl-1H-pyrazol-4-yl)cyclobutanecarboxamide[..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rma[1] H JHJ
N-(4-methoxyphenyl)-N'-pyridin-4-ylurea[18 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rmc[1] H 6SU
methyl 3-(methylsulfonylamino)benzoate[15 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
6xez[2] Y ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
F 100.0
/100.0
9
/9
R1AB_SARS2 nsp13
5rl6[1] H LJA
N-[3-(carbamoylamino)phenyl]acetamide[14 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rml[1] H VXD
N-(3-chloro-2-methylphenyl)glycinamide[13 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rmm[1] H VXG
(3S,4S)-1-acetyl-4-phenylpyrrolidine-3-carboxylic ..
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rm7[1] H N0E
~{N}-(4-hydroxyphenyl)-3-phenyl-propanamide[18 ato..
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rlw[1] C S9S
~{N}-[2-(4-fluorophenyl)ethyl]methanesulfonamide[1..
A 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rlw[1] I S9S
~{N}-[2-(4-fluorophenyl)ethyl]methanesulfonamide[1..
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rmi[1] C STV
~{N}-(1,3-benzodioxol-5-ylmethyl)ethanesulfonamide..
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rln[1] C NZG
3-(acetylamino)-4-fluorobenzoic acid[14 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rlq[1] C UVA
N-methyl-2-(methylsulfonyl)aniline[12 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rm9[1] H EJQ
~{N}-(4-fluorophenyl)-2-pyrrolidin-1-yl-ethanamide..
B 100.0
/100.0
10
/10
R1AB_SARS2 Helicase
5rmk[1] H O2A
N-methyl-1H-indole-7-carboxamide[13 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Helicase
5rm3[1] C S7J
2-(trifluoromethyl)pyrimidine-5-carboxamide[13 ato..
A 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rmd[2] I VWY
N-ethyl-4-[(methylsulfonyl)amino]benzamide[16 atom..
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rmb[1] C VWV
ethyl (1,1-dioxo-1lambda~6~,4-thiazinan-4-yl)aceta..
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rld[1] H VVY
2-phenoxy-1-(pyrrolidin-1-yl)ethan-1-one[15 atoms]..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rlf[1] C NY7
N-(2-methoxy-5-methylphenyl)glycinamide[14 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rm0[1] H S7G
~{N}-[(3~{R})-1,2,3,4-tetrahydroquinolin-3-yl]etha..
B 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rlz[1] C VWM
(3R)-1-acetyl-3-hydroxypiperidine-3-carboxylic aci..
A 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rlv[1] D VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rlv[1] J VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rlv[1] C VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rlr[1] H VWD
(1R)-2-(methylsulfonyl)-1-phenylethan-1-ol[13 atom..
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rm1[1] H RY4
N-[4-(aminomethyl)phenyl]methanesulfonamide[13 ato..
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rls[1] C VWG
N-hydroxyquinoline-2-carboxamide[14 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rlp[1] H VWA
(1S)-1-(4-fluorophenyl)-N-methylethan-1-amine[11 a..
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5rlw[102] J ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rlf[102] J ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rm0[102] C ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
6xez[2] W ZN
ZINC ION[1 atoms]
F 100.0
/100.0
5
/5
R1AB_SARS2 nsp13
6zsl[6] J ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 helicase NSP13
6jyt[6] D ZN
ZINC ION[1 atoms]
A 100.0
/99.8
5
/5
R1AB_CVHSA Helicase
6zsl[6] I ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 helicase NSP13
6xez[2] Q ZN
ZINC ION[1 atoms]
E 100.0
/100.0
4
/4
R1AB_SARS2 nsp13
6xez[2] O ZN
ZINC ION[1 atoms]
E 100.0
/100.0
6
/6
R1AB_SARS2 nsp13
6xez[2] AA MG
MAGNESIUM ION[1 atoms]
F 100.0
/100.0
3
/3
R1AB_SARS2 nsp13
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez[1] F R1AB_SARS2 nsp13[596 aa] E 100.0
/100.0
4
/4
R1AB_SARS2 nsp13
6xez[1] E R1AB_SARS2 nsp13[596 aa] F 100.0
/100.0
5
/5
R1AB_SARS2 nsp13
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5rmb[208] L PO4
PHOSPHATE ION[5 atoms]
B 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
6xez[2] S AF3
ALUMINUM FLUORIDE[4 atoms]
E 100.0
/100.0
7
/7
R1AB_SARS2 nsp13
5wwp[3] F SO4
SULFATE ION[5 atoms]
A 100.0
/72.3
5
/5
K0BWD0_9BETC ORF1ab
5wwp[1] K SO4
SULFATE ION[5 atoms]
B 100.0
/72.6
4
/4
K0BWD0_9BETC ORF1ab
5wwp[1] J SO4
SULFATE ION[5 atoms]
B 100.0
/72.6
6
/6
K0BWD0_9BETC ORF1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.