#WARNING:no index is registered index 'YP_009725308.1' in 'http://www.uniprot.org/uniprot/'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
36527 601 8 YP_009725308.1()
QUERYSEQ
AVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYG
IATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYP
SARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVD
TVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATL
Q
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725308.1()]

601
region name description
1-601 DISORDER predicted by DISOPRED (1-1,594-601)

MONOMER
601
pdb_id a1 identity[%]2 description
6xez E 100.0 R1AB_SARS2 nsp13
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez[1] A R1AB_SARS2 nsp12[926 aa] E 100.0
/100.0
3
/3
R1AB_SARS2 nsp13
6xez[1] D R1AB_SARS2 nsp8[186 aa] E 100.0
/100.0
4
/4
R1AB_SARS2 nsp13
6xez[1] B R1AB_SARS2 nsp8[186 aa] F 100.0
/100.0
10
/10
R1AB_SARS2 nsp13
6xez[1] C R1AB_SARS2 nsp7[73 aa] E 100.0
/100.0
1
/1
R1AB_SARS2 nsp13
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez[1] U 1N7
CHAPSO[36 atoms]
E 100.0
/100.0
3
/3
R1AB_SARS2 nsp13
6xez[2] Y ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
F 100.0
/100.0
9
/9
R1AB_SARS2 nsp13
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez[2] V ZN
ZINC ION[1 atoms]
F 100.0
/100.0
5
/5
R1AB_SARS2 nsp13
6xez[2] X ZN
ZINC ION[1 atoms]
F 100.0
/100.0
4
/4
R1AB_SARS2 nsp13
6jyt[6] C ZN
ZINC ION[1 atoms]
A 100.0
/99.8
4
/4
R1AB_CVHSA Helicase
6zsl[6] C ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 helicase NSP13
6zsl[6] E ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 helicase NSP13
6xez[2] W ZN
ZINC ION[1 atoms]
F 100.0
/100.0
5
/5
R1AB_SARS2 nsp13
6xez[2] AA MG
MAGNESIUM ION[1 atoms]
F 100.0
/100.0
3
/3
R1AB_SARS2 nsp13
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez[1] E R1AB_SARS2 nsp13[596 aa] F 100.0
/100.0
5
/5
R1AB_SARS2 nsp13
6xez[1] F R1AB_SARS2 nsp13[596 aa] E 100.0
/100.0
4
/4
R1AB_SARS2 nsp13
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6zsl[4] F PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 SARS-CoV-2 helicase NSP13
6xez[2] S AF3
ALUMINUM FLUORIDE[4 atoms]
E 100.0
/100.0
7
/7
R1AB_SARS2 nsp13
5wwp[3] F SO4
SULFATE ION[5 atoms]
A 100.0
/72.3
5
/5
K0BWD0_9BETC ORF1ab
5wwp[1] K SO4
SULFATE ION[5 atoms]
B 100.0
/72.6
4
/4
K0BWD0_9BETC ORF1ab
5wwp[1] J SO4
SULFATE ION[5 atoms]
B 100.0
/72.6
6
/6
K0BWD0_9BETC ORF1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.