[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
49125 527 10 YP_009725309.1(YP_009725309.1) RecName: Full=3'-to-5' exonuclease
QUERYSEQ
AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLI
PLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG
DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDS
PCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725309.1(YP_009725309.1)]

527
region name description
1-10 DISORDER predicted by DISOPRED (1-5,8-8,10-10)

MONOMER
527
pdb_id a1 identity[%]2 description
5c8s D 94.9 R1AB_CVHSA Guanine-N7 methyltransferase
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5nfy[4] E Q1T6X8_CVHSA Polyprotein 1ab[132 aa] A 98.0
/94.7
50
/50
Q1T6X8_CVHSA Polyprotein 1ab
5c8t[6] A R1AB_CVHSA Non-structural protein 10[133 aa] B 98.0
/94.9
49
/49
R1AB_CVHSA Guanine-N7 methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5c8s[2] L G3A
GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms..
B 100.0
/94.9
16
/16
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[2] K SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
B 100.0
/94.9
14
/14
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[2] R SAM
S-ADENOSYLMETHIONINE[27 atoms]
D 100.0
/94.9
15
/15
R1AB_CVHSA Guanine-N7 methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5nfy[4] V ZN
ZINC ION[1 atoms]
D 100.0
/94.7
4
/4
Q1T6X8_CVHSA Polyprotein 1ab
5c8t[4] P ZN
ZINC ION[1 atoms]
D 100.0
/94.9
5
/5
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[4] N ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5nfy[4] W ZN
ZINC ION[1 atoms]
D 100.0
/94.7
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
5c8t[4] O ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[2] O ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5nfy[4] U ZN
ZINC ION[1 atoms]
D 100.0
/94.7
6
/6
Q1T6X8_CVHSA Polyprotein 1ab
5c8s[2] P ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[2] I ZN
ZINC ION[1 atoms]
B 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8u[4] J MG
MAGNESIUM ION[1 atoms]
B 100.0
/94.9
3
/3
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[2] J MG
MAGNESIUM ION[1 atoms]
B 100.0
/94.9
3
/3
R1AB_CVHSA Guanine-N7 methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5nfy[2] L PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/94.7
2
/2
Q1T6X8_CVHSA Polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.