[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
53955 346 34 YP_009725310.1(YP_009725310.1) RecName: Full=endoRNAse
QUERYSEQ
SLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKG
LQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLD
DFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725310.1(YP_009725310.1)]

346
region name description
1-1 DISORDER predicted by DISOPRED (1-1)

MONOMER
346
pdb_id a1 identity[%]2 description
6vww A 100.0 NSP15 endoribnuclease
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
METAL
346 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6vww[3] E MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
6
/6
NSP15 endoribnuclease
6vww[3] L CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
3
/3
NSP15 endoribnuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
346 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6w01[12] A NSP15 Endoribonuclease[347 aa] B 100.0
/100.0
14
/15
NSP15 Endoribonuclease
6w01[6] A NSP15 Endoribonuclease[347 aa] B 100.0
/100.0
1
/1
NSP15 Endoribonuclease
6vww[12] A NSP15 endoribnuclease[348 aa] A 100.0
/100.0
27
/27
NSP15 endoribnuclease
6vww[12] A NSP15 endoribnuclease[348 aa] A 100.0
/100.0
26
/26
NSP15 endoribnuclease
2rhb[6] E R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] D 88.0
/88.4
25
/25
R1AB_CVHSA Uridylate-specific endoribonuclease
2rhb[6] D R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] B 92.9
/88.4
14
/16
R1AB_CVHSA Uridylate-specific endoribonuclease
2h85[6] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 92.9
/88.1
14
/16
Q6VA80_CVHSA Putative orf1ab polyprotein
2h85[6] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 85.2
/88.1
27
/27
Q6VA80_CVHSA Putative orf1ab polyprotein
2ozk[4] B R1AB_CVHSA Uridylate-specific endoribonuclease[305 aa] C 100.0
/88.3
3
/3
R1AB_CVHSA Uridylate-specific endoribonuclease
2h85[12] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 85.7
/88.1
28
/28
Q6VA80_CVHSA Putative orf1ab polyprotein
2ozk[2] D R1AB_CVHSA Uridylate-specific endoribonuclease[296 aa] A 66.7
/88.6
3
/3
R1AB_CVHSA Uridylate-specific endoribonuclease
2ozk[2] A R1AB_CVHSA Uridylate-specific endoribonuclease[306 aa] C 85.7
/88.3
14
/14
R1AB_CVHSA Uridylate-specific endoribonuclease
2ozk[2] B R1AB_CVHSA Uridylate-specific endoribonuclease[305 aa] A 86.7
/88.6
30
/30
R1AB_CVHSA Uridylate-specific endoribonuclease
5yvd[6] A A0A0U2GPI9_9BETC Nsp15[341 aa] A 40.0
/51.9
25
/25
A0A0U2GPI9_9BETC Nsp15
5yvd[6] A A0A0U2GPI9_9BETC Nsp15[341 aa] A 41.4
/51.9
29
/29
A0A0U2GPI9_9BETC Nsp15
5yvd[6] A A0A0U2GPI9_9BETC Nsp15[341 aa] B 100.0
/51.9
1
/1
A0A0U2GPI9_9BETC Nsp15
5yvd[6] A A0A0U2GPI9_9BETC Nsp15[341 aa] B 60.0
/51.9
15
/16
A0A0U2GPI9_9BETC Nsp15
5yvd[6] B A0A0U2GPI9_9BETC Nsp15[341 aa] A 25.0
/51.9
4
/4
A0A0U2GPI9_9BETC Nsp15
2gth[12] A R1AB_CVMA5 Replicase polyprotein 1ab[348 aa] A 33.3
/49.5
24
/24
R1AB_CVMA5 Replicase polyprotein 1ab
2gth[12] A R1AB_CVMA5 Replicase polyprotein 1ab[348 aa] A 47.8
/49.5
23
/24
R1AB_CVMA5 Replicase polyprotein 1ab
2gth[12] A R1AB_CVMA5 Replicase polyprotein 1ab[348 aa] A 37.5
/49.5
8
/8
R1AB_CVMA5 Replicase polyprotein 1ab
2gti[12] A R1AB_CVMA5 Replicase polyprotein 1ab[348 aa] A 58.8
/49.2
17
/17
R1AB_CVMA5 Replicase polyprotein 1ab
4rs4[18] F R1AB_CVH22 Uridylate-specific endoribonuclease[346 aa] A 16.7
/45.3
6
/6
R1AB_CVH22 Uridylate-specific endoribonuclease
4rs4[18] A R1AB_CVH22 Uridylate-specific endoribonuclease[341 aa] C 30.8
/46.7
26
/26
R1AB_CVH22 Uridylate-specific endoribonuclease
4rs4[18] B R1AB_CVH22 Uridylate-specific endoribonuclease[345 aa] A 60.0
/45.3
15
/17
R1AB_CVH22 Uridylate-specific endoribonuclease
4s1t[18] F R1AB_CVH22 Uridylate-specific endoribonuclease[342 aa] B 38.9
/45.0
18
/20
R1AB_CVH22 Uridylate-specific endoribonuclease
5da1[1] B E3V2B6_PRRSV endoribonuclease[205 aa] A 18.8
/30.1
16
/16
E3V2B6_PRRSV endoribonuclease
5hc1[1] A RPOA_EAVBU Non-structural protein 11[219 aa] D 0.0
/29.2
2
/15
RPOA_EAVBU Non-structural protein 11
5hc1[1] D RPOA_EAVBU Non-structural protein 11[220 aa] A 31.2
/29.2
16
/17
RPOA_EAVBU Non-structural protein 11
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
346 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6vww[6] M GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
NSP15 endoribnuclease
2gti[6] K GOL
GLYCEROL[6 atoms]
A 25.0
/49.2
4
/4
R1AB_CVMA5 Replicase polyprotein 1ab
2gti[6] K GOL
GLYCEROL[6 atoms]
A 0.0
/49.2
1
/1
R1AB_CVMA5 Replicase polyprotein 1ab
2gti[6] J GOL
GLYCEROL[6 atoms]
A 60.0
/49.2
5
/5
R1AB_CVMA5 Replicase polyprotein 1ab
6vww[6] F GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
4
/4
NSP15 endoribnuclease
6vww[3] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
NSP15 endoribnuclease
6vww[6] G GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
NSP15 endoribnuclease
6vww[3] I GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
NSP15 endoribnuclease
5yvd[6] C GOL
GLYCEROL[6 atoms]
A 100.0
/51.9
6
/6
A0A0U2GPI9_9BETC Nsp15
6vww[3] N GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
NSP15 endoribnuclease
6vww[3] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
1
/1
NSP15 endoribnuclease
6w01[9] Y EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
NSP15 Endoribonuclease
6w01[3] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
NSP15 Endoribonuclease
6w01[3] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
NSP15 Endoribonuclease
6w01[3] S EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
NSP15 Endoribonuclease
6w01[6] Q EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
4
/4
NSP15 Endoribonuclease
6w01[6] W EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
NSP15 Endoribonuclease
6w01[3] L EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
NSP15 Endoribonuclease
6w01[6] D EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
NSP15 Endoribonuclease
6w01[3] BA EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
4
/4
NSP15 Endoribonuclease
6w01[6] T EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
4
/4
NSP15 Endoribonuclease
6w01[3] T EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
1
/1
NSP15 Endoribonuclease
6w01[3] V EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
6
/6
NSP15 Endoribonuclease
6w01[6] R EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
NSP15 Endoribonuclease
6w01[6] Z EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
NSP15 Endoribonuclease
6w01[3] M EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
NSP15 Endoribonuclease
6w01[3] K EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
NSP15 Endoribonuclease
6w01[3] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
8
/8
NSP15 Endoribonuclease
6w01[6] N CIT
CITRIC ACID[13 atoms]
A 100.0
/100.0
9
/9
NSP15 Endoribonuclease
6vww[3] P ACY
ACETIC ACID[4 atoms]
B 100.0
/100.0
8
/8
NSP15 endoribnuclease
6vww[3] O ACY
ACETIC ACID[4 atoms]
B 100.0
/100.0
6
/6
NSP15 endoribnuclease
6vww[3] H ACY
ACETIC ACID[4 atoms]
A 100.0
/100.0
3
/3
NSP15 endoribnuclease
6w01[3] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
7
/7
NSP15 Endoribonuclease
6w01[6] H PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
6
/6
NSP15 Endoribonuclease
2gti[6] I SO4
SULFATE ION[5 atoms]
A 33.3
/49.2
3
/3
R1AB_CVMA5 Replicase polyprotein 1ab
2gti[6] G SO4
SULFATE ION[5 atoms]
A 50.0
/49.2
2
/2
R1AB_CVMA5 Replicase polyprotein 1ab
2gti[6] D SO4
SULFATE ION[5 atoms]
A 20.0
/49.2
5
/5
R1AB_CVMA5 Replicase polyprotein 1ab
2gti[6] E SO4
SULFATE ION[5 atoms]
A 0.0
/49.2
3
/3
R1AB_CVMA5 Replicase polyprotein 1ab
2gti[6] C SO4
SULFATE ION[5 atoms]
A 60.0
/49.2
5
/5
R1AB_CVMA5 Replicase polyprotein 1ab
2gti[6] H SO4
SULFATE ION[5 atoms]
A 50.0
/49.2
2
/3
R1AB_CVMA5 Replicase polyprotein 1ab
4s1t[12] K PO4
PHOSPHATE ION[5 atoms]
E 100.0
/45.0
5
/5
R1AB_CVH22 Uridylate-specific endoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.