[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
51766 298 20 YP_009725311.1(YP_009725311.1) RecName: Full=2'-O-ribose methyltransferase
QUERYSEQ
SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFF
TYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725311.1(YP_009725311.1)]

298
region name description
1-298 DISORDER predicted by DISOPRED (1-3,295-298)

MONOMER
298
pdb_id a1 identity[%]2 description
6w4h A 100.0 nsp16
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
298 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3r24[1] B R1A_CVHSA Non-structural protein 10 and Non-structural prote.. A 100.0
/93.5
21
/21
R1AB_CVHSA 2'-O-methyl transferase
6w61[7] B Stimulatory factor NSP10[115 aa] A 100.0
/100.0
21
/21
2'-O-methyltransferase NSP16
5yni[12] B K4LC41_9BETC nsp10 protein[120 aa] A 61.9
/66.3
21
/21
K0BWD0_9BETC nsp16 protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
298 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6w4h[1] G BDF
BETA-D-FRUCTOPYRANOSE[12 atoms]
A 100.0
/100.0
4
/4
nsp16
6w4h[1] J BDF
BETA-D-FRUCTOPYRANOSE[12 atoms]
A 100.0
/100.0
1
/1
nsp16
5ynf[4] C GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 89.5
/65.9
19
/19
K0BWD0_9BETC nsp16 protein
5ynq[5] C SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 94.7
/66.0
19
/19
K0BWD0_9BETC nsp16 protein
5ynj[4] C GTG
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52..
A 94.1
/65.9
17
/17
K0BWD0_9BETC nsp16 protein
2xyr[4] H SFG
SINEFUNGIN[27 atoms]
A 100.0
/94.1
17
/17
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6w61[4] F SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
18
/18
2'-O-methyltransferase NSP16
3r24[1] C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/93.5
19
/19
R1AB_CVHSA 2'-O-methyl transferase
6w4h[3] D SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
18
/18
nsp16
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
298 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2xyr[3] I MG
MAGNESIUM ION[1 atoms]
A 0.0
/94.1
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyv[3] C NA
SODIUM ION[1 atoms]
A 100.0
/94.4
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyq[2] G NA
SODIUM ION[1 atoms]
A 100.0
/93.7
6
/6
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyv[1] E NA
SODIUM ION[1 atoms]
A 100.0
/94.4
4
/4
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6w75[1] U NA
SODIUM ION[1 atoms]
C 100.0
/100.0
2
/2
NSP16
6w75[2] S NA
SODIUM ION[1 atoms]
C 100.0
/100.0
4
/4
NSP16
6w75[1] T NA
SODIUM ION[1 atoms]
C 100.0
/100.0
2
/2
NSP16
6w75[1] V NA
SODIUM ION[1 atoms]
C 100.0
/100.0
3
/3
NSP16
2xyr[1] E CL
CHLORIDE ION[1 atoms]
A 100.0
/94.1
4
/4
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyq[3] C CL
CHLORIDE ION[1 atoms]
A 100.0
/93.7
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyv[3] G CL
CHLORIDE ION[1 atoms]
A 100.0
/94.4
3
/3
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6w61[1] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
2'-O-methyltransferase NSP16
2xyv[1] I CL
CHLORIDE ION[1 atoms]
A 100.0
/94.4
2
/2
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyv[2] F CL
CHLORIDE ION[1 atoms]
A 75.0
/94.4
4
/4
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
298 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6w75[6] BA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
2
/2
NSP16
6w75[1] O FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
NSP16
6w75[2] FA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
4
/4
NSP16
6w75[1] AA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
2
/2
NSP16
6w75[1] KA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
1
/1
NSP16
6w75[2] X FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
6
/6
NSP16
6w75[1] CA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
6
/6
NSP16
6w75[2] L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
2
/2
NSP16
6w75[2] DA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
3
/3
NSP16
6w75[2] M FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
NSP16
6w61[1] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
7
/7
2'-O-methyltransferase NSP16
6w61[1] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
2'-O-methyltransferase NSP16
6w4h[1] C SO3
SULFITE ION[4 atoms]
A 100.0
/100.0
1
/1
nsp16
6w4h[1] E ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
5
/5
nsp16
6w4h[1] F ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
7
/7
nsp16
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.