[Summary Bars]

[SiteTable]


Full Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57782 468 51 P08887(IL6RA_HUMAN) RecName: Full=Interleukin-6 receptor subunit alpha {ECO:0000305}; Short=IL-6 receptor subunit alpha; Short=IL-6R subunit alpha; Short=IL-6R-alpha; Short=IL-6RA;AltName: Full=IL-6R 1;AltName: Full=Membrane glycoprotein 80; Short=gp80;AltName: CD_antigen=CD126;Contains: RecName: Full=Soluble interleukin-6 receptor subunit alpha {ECO:0000305}; Short=sIL6R {ECO:0000303|PubMed:12794819, ECO:0000303|PubMed:26876177, ECO:0000303|PubMed:28060820};Flags: Precursor;
QUERYSEQ
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV
RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDA
RDPRSPYDISNTDYFFPR
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P08887(IL6RA_HUMAN)]

468
region name description
1-19 SIGNAL
20-468 CHAIN /note="Interleukin-6 receptor subunit alpha" /id="PRO_0000010895"
20-355 CHAIN /note="Soluble interleukin-6 receptor subunit alpha" /id="PRO_0000450730"
20-365 TOPO_DOM /note="Extracellular"
366-386 TRANSMEM /note="Helical"
387-468 TOPO_DOM /note="Cytoplasmic"
26-112 DOMAIN /note="Ig-like C2-type"
113-217 DOMAIN /note="Fibronectin type-III 1"
218-316 DOMAIN /note="Fibronectin type-III 2"
1-468 DISORDER predicted by DISOPRED (1-18,313-331,333-334,341-352,354-354,358-358,406-413,420-468)

MONOMER
468
pdb_id a1 identity[%]2 description
1n26 A 100.0 IL6A_HUMAN IL-6 Receptor alpha chain
1p9m C 100.0 IL6RA_HUMAN Interleukin-6 receptor alpha chain
5fuc C 99.0 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-6 RECEPTOR
5fuc D 99.0 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-6 RECEPTOR
2arw A 100.0 IL6RA_HUMAN Interleukin-6 receptor alpha chain
6o4p A 35.0 I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p B 35.4 I11RA_HUMAN Interleukin-11 receptor subunit alpha
1uc6 A 40.8 CNTFR_HUMAN Ciliary Neurotrophic Factor Receptor alpha
1f42 A 28.9 I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
3duh A 28.6 IL12B_HUMAN Interleukin-12 subunit beta
5mzv A 28.0 IL12B_HUMAN Interleukin-12 subunit beta
3hmx A 29.0 IL12B_HUMAN Interleukin-12 subunit beta
4grw B 29.2 IL12B_HUMAN Interleukin-12 subunit beta
3qwr A 28.9 IL12B_HUMAN Interleukin-12 subunit beta
5mj3 A 28.3 IL12B_HUMAN Interleukin-12 subunit beta
3d87 B 28.8 IL12B_HUMAN Interleukin-12 subunit p40
3d87 D 28.9 IL12B_HUMAN Interleukin-12 subunit p40
5mxa B 28.0 IL12B_HUMAN Interleukin-12 subunit beta
1bqu B 29.9 IL6RB_HUMAN PROTEIN (GP130)
1pvh A 29.9 IL6RB_HUMAN Interleukin-6 receptor beta chain
1pvh C 29.9 IL6RB_HUMAN Interleukin-6 receptor beta chain
3l5h A 28.8 IL6RB_HUMAN Interleukin-6 receptor subunit beta
1bqu A 30.2 IL6RB_HUMAN PROTEIN (GP130)
1i1r A 28.2 IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN
3duh B 28.5 IL12B_HUMAN Interleukin-12 subunit beta
1p9m A 28.9 IL6RB_HUMAN Interleukin-6 receptor beta chain
5njd E 28.8 IL12B_HUMAN Interleukin-12 subunit beta
5njd C 28.4 IL12B_HUMAN Interleukin-12 subunit beta
4grw D 28.5 IL12B_HUMAN Interleukin-12 subunit beta
1f45 A 30.4 I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
5njd A 27.9 IL12B_HUMAN Interleukin-12 subunit beta
5njd I 28.6 IL12B_HUMAN Interleukin-12 subunit beta
5mj4 A 29.0 IL12B_HUMAN Interleukin-12 subunit beta
5njd G 28.4 IL12B_HUMAN Interleukin-12 subunit beta
5njd K 28.5 IL12B_HUMAN Interleukin-12 subunit beta
3d85 D 28.3 IL12B_HUMAN Interleukin-12 subunit p40
1bj8 A 27.5 IL6RB_HUMAN GP130
3ew3 B 25.4 PRLR_RAT Prolactin receptor
3npz B 25.7 PRLR_RAT Prolactin receptor
3ncb B 24.7 PRLR_HUMAN Prolactin receptor
3n0p B 24.7 PRLR_HUMAN Prolactin receptor
3mzg B 24.7 PRLR_HUMAN Prolactin receptor
3n06 B 24.7 PRLR_HUMAN Prolactin receptor
3npz C 26.1 PRLR_RAT Prolactin receptor
3nce B 24.7 PRLR_HUMAN Prolactin receptor
3ncf B 24.7 PRLR_HUMAN Prolactin receptor
3ncc B 24.7 PRLR_HUMAN Prolactin receptor
6uib B 28.6 IL12B_HUMAN Interleukin-12 subunit beta
3d48 B 25.1 PRLR_HUMAN Prolactin receptor
4i18 E 24.9 PRLR_HUMAN Prolactin receptor
1f6f B 25.3 PRLR_RAT PROLACTIN RECEPTOR
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1p9m A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0
8
/8
IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0
12
/12
IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0
8
/8
IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0
12
/12
IL6RA_HUMAN Interleukin-6 receptor alpha chain
5fuc E VHH6[110 aa] C 100.0
/99.0
10
/10
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5fuc F VHH6[124 aa] D 100.0
/99.0
10
/10
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5fuc A IL6_HUMAN INTERLEUKIN-6[152 aa] D 100.0
/99.0
12
/12
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
1f45 B I12A_HUMAN INTERLEUKIN-12 ALPHA CHAIN[133 aa] A 25.0
/30.4
20
/21
I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
1pvh B LIF_HUMAN Leukemia inhibitory factor[169 aa] A 23.1
/29.9
13
/13
IL6RB_HUMAN Interleukin-6 receptor beta chain
1pvh D LIF_HUMAN Leukemia inhibitory factor[169 aa] C 21.4
/29.9
14
/14
IL6RB_HUMAN Interleukin-6 receptor beta chain
4grw E Nanobody 124C4[125 aa] D 21.4
/28.5
14
/16
IL12B_HUMAN Interleukin-12 subunit beta
4grw G Nanobody 124C4[125 aa] B 23.1
/29.2
13
/15
IL12B_HUMAN Interleukin-12 subunit beta
4grw F Nanobody 37D5[125 aa] D 25.0
/28.5
4
/4
IL12B_HUMAN Interleukin-12 subunit beta
4grw J Nanobody 37D5[122 aa] B 75.0
/29.2
4
/4
IL12B_HUMAN Interleukin-12 subunit beta
4grw I Nanobody 22E11[123 aa] D 9.1
/28.5
11
/18
IL12B_HUMAN Interleukin-12 subunit beta
5mzv D Nanobody 22E11[123 aa] A 7.7
/28.0
13
/20
IL12B_HUMAN Interleukin-12 subunit beta
4grw H Nanobody 22E11[123 aa] B 0.0
/29.2
10
/17
IL12B_HUMAN Interleukin-12 subunit beta
5njd F IL23A_HUMAN Interleukin-23 subunit alpha[146 aa] E 20.0
/28.8
15
/16
IL12B_HUMAN Interleukin-12 subunit beta
6uib A IL23A_HUMAN Interleukin-23 subunit alpha[132 aa] B 12.5
/28.6
16
/17
IL12B_HUMAN Interleukin-12 subunit beta
5njd B IL23A_HUMAN Interleukin-23 subunit alpha[144 aa] A 18.8
/27.9
16
/17
IL12B_HUMAN Interleukin-12 subunit beta
5njd L IL23A_HUMAN Interleukin-23 subunit alpha[139 aa] K 13.3
/28.5
15
/16
IL12B_HUMAN Interleukin-12 subunit beta
5njd H IL23A_HUMAN Interleukin-23 subunit alpha[139 aa] G 20.0
/28.4
15
/16
IL12B_HUMAN Interleukin-12 subunit beta
3d85 C IL23A_HUMAN Interleukin-23 subunit p19[133 aa] D 12.5
/28.3
16
/17
IL12B_HUMAN Interleukin-12 subunit p40
5mxa A IL23A_HUMAN Interleukin-23 subunit alpha[140 aa] B 14.3
/28.0
14
/15
IL12B_HUMAN Interleukin-12 subunit beta
3qwr B IL23A_HUMAN Interleukin-23 subunit alpha[141 aa] A 12.5
/28.9
16
/17
IL12B_HUMAN Interleukin-12 subunit beta
4grw C IL23A_HUMAN Interleukin-23 subunit alpha[129 aa] D 17.6
/28.5
17
/18
IL12B_HUMAN Interleukin-12 subunit beta
5njd D IL23A_HUMAN Interleukin-23 subunit alpha[146 aa] C 18.8
/28.4
16
/17
IL12B_HUMAN Interleukin-12 subunit beta
4grw A IL23A_HUMAN Interleukin-23 subunit alpha[130 aa] B 18.8
/29.2
16
/17
IL12B_HUMAN Interleukin-12 subunit beta
3hmx D USTEKINUMAB FAB HEAVY CHAIN[217 aa] A 25.0
/29.0
12
/13
IL12B_HUMAN Interleukin-12 subunit beta
4i18 C antibody light chain[215 aa] E 60.0
/24.9
5
/5
PRLR_HUMAN Prolactin receptor
3hmx C USTEKINUMAB FAB LIGHT CHAIN[214 aa] A 14.3
/29.0
7
/9
IL12B_HUMAN Interleukin-12 subunit beta
3hmx B IL12A_HUMAN Interleukin-12 subunit alpha[176 aa] A 17.6
/29.0
17
/18
IL12B_HUMAN Interleukin-12 subunit beta
1p9m C IL6RA_HUMAN Interleukin-6 receptor alpha chain[201 aa] A 10.0
/28.9
10
/11
IL6RB_HUMAN Interleukin-6 receptor beta chain
1p9m C IL6RA_HUMAN Interleukin-6 receptor alpha chain[201 aa] A 10.0
/28.9
10
/11
IL6RB_HUMAN Interleukin-6 receptor beta chain
5fuc B IL6_HUMAN INTERLEUKIN-6[160 aa] C 100.0
/99.0
18
/18
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
1p9m B IL6_HUMAN Interleukin-6[163 aa] C 100.0
/100.0
15
/15
IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m B IL6_HUMAN Interleukin-6[163 aa] A 33.3
/28.9
12
/12
IL6RB_HUMAN Interleukin-6 receptor beta chain
1p9m B IL6_HUMAN Interleukin-6[163 aa] C 100.0
/100.0
15
/15
IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m B IL6_HUMAN Interleukin-6[163 aa] A 33.3
/28.9
12
/12
IL6RB_HUMAN Interleukin-6 receptor beta chain
3qwr C ADNECTIN[91 aa] A 28.6
/28.9
21
/22
IL12B_HUMAN Interleukin-12 subunit beta
6uib C Peptide 23-652[15 aa] B 25.0
/28.6
12
/12
IL12B_HUMAN Interleukin-12 subunit beta
5njd J IL23A_HUMAN Interleukin-23 subunit alpha[141 aa] I 18.8
/28.6
16
/16
IL12B_HUMAN Interleukin-12 subunit beta
3duh C IL23A_HUMAN Interleukin-23 subunit alpha[137 aa] A 13.3
/28.6
15
/16
IL12B_HUMAN Interleukin-12 subunit beta
3duh D IL23A_HUMAN Interleukin-23 subunit alpha[137 aa] B 12.5
/28.5
16
/17
IL12B_HUMAN Interleukin-12 subunit beta
5njd V Briakinumab FAb Heavy chain[205 aa] A 0.0
/27.9
2
/10
IL12B_HUMAN Interleukin-12 subunit beta
5njd N Briakinumab FAb Heavy chain[207 aa] K 0.0
/28.5
3
/11
IL12B_HUMAN Interleukin-12 subunit beta
5njd X Briakinumab FAb Heavy chain[206 aa] E 0.0
/28.8
2
/10
IL12B_HUMAN Interleukin-12 subunit beta
5njd T Briakinumab FAb Heavy chain[208 aa] G 0.0
/28.4
3
/10
IL12B_HUMAN Interleukin-12 subunit beta
5njd P Briakinumab FAb Heavy chain[207 aa] I 0.0
/28.6
4
/12
IL12B_HUMAN Interleukin-12 subunit beta
5njd R Briakinumab FAb Heavy chain[208 aa] C 0.0
/28.4
4
/11
IL12B_HUMAN Interleukin-12 subunit beta
5njd U Briakinumab FAb Light chain[215 aa] A 0.0
/27.9
3
/8
IL12B_HUMAN Interleukin-12 subunit beta
5njd Q Briakinumab FAb Light chain[213 aa] C 0.0
/28.4
2
/7
IL12B_HUMAN Interleukin-12 subunit beta
5njd O Briakinumab FAb Light chain[213 aa] I 0.0
/28.6
1
/6
IL12B_HUMAN Interleukin-12 subunit beta
5njd W Briakinumab FAb Light chain[214 aa] E 0.0
/28.8
2
/7
IL12B_HUMAN Interleukin-12 subunit beta
5njd M Briakinumab FAb Light chain[213 aa] K 0.0
/28.5
3
/8
IL12B_HUMAN Interleukin-12 subunit beta
5njd S Briakinumab FAb Light chain[214 aa] G 0.0
/28.4
2
/7
IL12B_HUMAN Interleukin-12 subunit beta
3d87 C IL23A_HUMAN Interleukin-23 subunit p19[159 aa] D 18.8
/28.9
16
/17
IL12B_HUMAN Interleukin-12 subunit p40
3d87 C IL23A_HUMAN Interleukin-23 subunit p19[159 aa] B 0.0
/28.8
2
/2
IL12B_HUMAN Interleukin-12 subunit p40
3d87 A IL23A_HUMAN Interleukin-23 subunit p19[161 aa] B 16.7
/28.8
18
/19
IL12B_HUMAN Interleukin-12 subunit p40
5mj4 B IL23A_HUMAN Interleukin-23 subunit alpha[162 aa] A 13.3
/29.0
15
/16
IL12B_HUMAN Interleukin-12 subunit beta
5mj3 B IL23A_HUMAN Interleukin-23 subunit alpha[155 aa] A 14.3
/28.3
21
/22
IL12B_HUMAN Interleukin-12 subunit beta
1i1r B Q98823_HHV8 VIRAL IL-6[167 aa] A 36.4
/28.2
11
/11
IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN
1i1r B Q98823_HHV8 VIRAL IL-6[167 aa] A 36.4
/28.2
11
/11
IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN
5mzv B IL23A_HUMAN Interleukin-23 subunit alpha[137 aa] A 18.8
/28.0
16
/17
IL12B_HUMAN Interleukin-12 subunit beta
5mzv C IL23R_HUMAN Interleukin-23 receptor[293 aa] A 0.0
/28.0
2
/6
IL12B_HUMAN Interleukin-12 subunit beta
3ew3 A PRL_HUMAN Prolactin[185 aa] B 0.0
/25.4
20
/21
PRLR_RAT Prolactin receptor
1f6f A CSH_SHEEP PLACENTAL LACTOGEN[183 aa] B 4.5
/25.3
22
/23
PRLR_RAT PROLACTIN RECEPTOR
3d48 A PRL_HUMAN Prolactin[165 aa] B 0.0
/25.1
21
/22
PRLR_HUMAN Prolactin receptor
4i18 D antibody heavy chain[220 aa] E 20.0
/24.9
20
/21
PRLR_HUMAN Prolactin receptor
3n0p A PRL_HUMAN Prolactin[186 aa] B 0.0
/24.7
21
/22
PRLR_HUMAN Prolactin receptor
3mzg A PRL_HUMAN Prolactin[186 aa] B 0.0
/24.7
21
/22
PRLR_HUMAN Prolactin receptor
3ncf A PRL_HUMAN Prolactin[186 aa] B 0.0
/24.7
22
/23
PRLR_HUMAN Prolactin receptor
3npz A PRL_HUMAN Prolactin[186 aa] B 0.0
/25.7
23
/24
PRLR_RAT Prolactin receptor
3ncb A PRL_HUMAN Prolactin[186 aa] B 0.0
/24.7
20
/21
PRLR_HUMAN Prolactin receptor
3ncc A PRL_HUMAN Prolactin[186 aa] B 0.0
/24.7
20
/21
PRLR_HUMAN Prolactin receptor
3npz A PRL_HUMAN Prolactin[186 aa] C 0.0
/26.1
14
/15
PRLR_RAT Prolactin receptor
3n06 A PRL_HUMAN Prolactin[186 aa] B 0.0
/24.7
21
/22
PRLR_HUMAN Prolactin receptor
3nce A PRL_HUMAN Prolactin[186 aa] B 0.0
/24.7
21
/22
PRLR_HUMAN Prolactin receptor
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26 H CYS
CYSTEINE[7 atoms]
A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
1n26 H CYS
CYSTEINE[7 atoms]
A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
1n26 E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
6o4p E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/35.0
4
/4
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1n26 E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
1n26 E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
1n26 D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
6uib E NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 0.0
/28.6
1
/3
IL12B_HUMAN Interleukin-12 subunit beta
3duh E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/28.6
2
/7
IL12B_HUMAN Interleukin-12 subunit beta
5fuc H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.0
1
/1
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5fuc I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/99.0
2
/2
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5fuc G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.0
3
/3
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
6uib D NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 0.0
/28.6
4
/7
IL12B_HUMAN Interleukin-12 subunit beta
5fuc J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/99.0
2
/2
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
3duh F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/28.5
3
/7
IL12B_HUMAN Interleukin-12 subunit beta
1n26 D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
1f42 D MNB
5-MERCAPTO-2-NITRO-BENZOIC ACID[13 atoms]
A 50.0
/28.9
6
/6
I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
1f42 C MNB
5-MERCAPTO-2-NITRO-BENZOIC ACID[13 atoms]
A 66.7
/28.9
3
/3
I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
3d87 G MAN
alpha-D-mannopyranose[11 atoms]
D 0.0
/28.9
4
/4
IL12B_HUMAN Interleukin-12 subunit p40
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1pvh E IOD
IODIDE ION[1 atoms]
A 100.0
/29.9
1
/1
IL6RB_HUMAN Interleukin-6 receptor beta chain
3d87 I K
POTASSIUM ION[1 atoms]
D 25.0
/28.9
4
/4
IL12B_HUMAN Interleukin-12 subunit p40
3d87 F K
POTASSIUM ION[1 atoms]
B 50.0
/28.8
2
/2
IL12B_HUMAN Interleukin-12 subunit p40
3ncb G NA
SODIUM ION[1 atoms]
B 40.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
3mzg C NA
SODIUM ION[1 atoms]
B 0.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3ncb E NA
SODIUM ION[1 atoms]
B 0.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3n0p C NA
SODIUM ION[1 atoms]
B 0.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
3n06 C NA
SODIUM ION[1 atoms]
B 0.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3ncf C NA
SODIUM ION[1 atoms]
B 0.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
5mj3 I NA
SODIUM ION[1 atoms]
A 0.0
/28.3
3
/3
IL12B_HUMAN Interleukin-12 subunit beta
3mzg E NA
SODIUM ION[1 atoms]
B 40.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
3ncf D NA
SODIUM ION[1 atoms]
B 0.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3nce I NA
SODIUM ION[1 atoms]
B 40.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
3n06 F NA
SODIUM ION[1 atoms]
B 40.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
3n06 D NA
SODIUM ION[1 atoms]
B 0.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
3mzg F NA
SODIUM ION[1 atoms]
B 0.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
3n0p D NA
SODIUM ION[1 atoms]
B 0.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3ncf F NA
SODIUM ION[1 atoms]
B 25.0
/24.7
4
/4
PRLR_HUMAN Prolactin receptor
3n0p F NA
SODIUM ION[1 atoms]
B 40.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
3ncc C NA
SODIUM ION[1 atoms]
B 0.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
3nce F NA
SODIUM ION[1 atoms]
B 0.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
5mj3 H NA
SODIUM ION[1 atoms]
A 33.3
/28.3
3
/3
IL12B_HUMAN Interleukin-12 subunit beta
3ncb D NA
SODIUM ION[1 atoms]
B 0.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
3ncc F NA
SODIUM ION[1 atoms]
B 40.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
3nce C NA
SODIUM ION[1 atoms]
B 0.0
/24.7
2
/3
PRLR_HUMAN Prolactin receptor
3ncc D NA
SODIUM ION[1 atoms]
B 0.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
5mzv K NA
SODIUM ION[1 atoms]
A 100.0
/28.0
1
/1
IL12B_HUMAN Interleukin-12 subunit beta
3nce G NA
SODIUM ION[1 atoms]
B 0.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3ncf E CL
CHLORIDE ION[1 atoms]
B 50.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3n06 E CL
CHLORIDE ION[1 atoms]
B 50.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3n0p E CL
CHLORIDE ION[1 atoms]
B 50.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
5mzv J CL
CHLORIDE ION[1 atoms]
A 0.0
/28.0
2
/3
IL12B_HUMAN Interleukin-12 subunit beta
3mzg D CL
CHLORIDE ION[1 atoms]
B 50.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3ncc E CL
CHLORIDE ION[1 atoms]
B 50.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3nce H CL
CHLORIDE ION[1 atoms]
B 50.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3ncb F CL
CHLORIDE ION[1 atoms]
B 50.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26 B 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al.. A 100.0
/100.0
9
/9
IL6A_HUMAN IL-6 Receptor alpha chain
1n26 B 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al.. A 100.0
/100.0
9
/9
IL6A_HUMAN IL-6 Receptor alpha chain
1n26 C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
3l5h B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/28.8
2
/2
IL6RB_HUMAN Interleukin-6 receptor subunit beta
1n26 C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
6o4p D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/35.4
4
/4
I11RA_HUMAN Interleukin-11 receptor subunit alpha
5njd Y alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 25.0
/27.9
4
/8
IL12B_HUMAN Interleukin-12 subunit beta
5njd DA alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. K 25.0
/28.5
4
/7
IL12B_HUMAN Interleukin-12 subunit beta
5njd BA alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. G 25.0
/28.4
4
/8
IL12B_HUMAN Interleukin-12 subunit beta
3hmx E alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 0.0
/29.0
3
/7
IL12B_HUMAN Interleukin-12 subunit beta
5mj3 D alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 0.0
/28.3
3
/7
IL12B_HUMAN Interleukin-12 subunit beta
4grw L alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. D 0.0
/28.5
2
/8
IL12B_HUMAN Interleukin-12 subunit beta
5njd CA alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. I 25.0
/28.6
4
/7
IL12B_HUMAN Interleukin-12 subunit beta
5njd AA alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. E 25.0
/28.8
4
/7
IL12B_HUMAN Interleukin-12 subunit beta
5njd Z alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 25.0
/28.4
4
/7
IL12B_HUMAN Interleukin-12 subunit beta
4grw K alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 0.0
/29.2
3
/9
IL12B_HUMAN Interleukin-12 subunit beta
5mj4 D alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 0.0
/29.0
2
/7
IL12B_HUMAN Interleukin-12 subunit beta
1f45 C alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 0.0
/30.4
3
/7
I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
1f42 B alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 0.0
/28.9
3
/7
I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
3l5h C beta-D-mannopyranose-(1-4)-beta-D-mannopyranose-(1.. A 0.0
/28.8
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
5mzv E alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 25.0
/28.0
4
/10
IL12B_HUMAN Interleukin-12 subunit beta
6o4p C alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 0.0
/35.0
5
/5
I11RA_HUMAN Interleukin-11 receptor subunit alpha
3qwr D alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 0.0
/28.9
3
/7
IL12B_HUMAN Interleukin-12 subunit beta
5mxa C alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 0.0
/28.0
2
/8
IL12B_HUMAN Interleukin-12 subunit beta
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26 A IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] A 100.0
/100.0
15
/15
IL6A_HUMAN IL-6 Receptor alpha chain
1n26 A IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] A 100.0
/100.0
11
/11
IL6A_HUMAN IL-6 Receptor alpha chain
1bqu B IL6RB_HUMAN PROTEIN (GP130)[215 aa] A 33.3
/30.2
9
/9
IL6RB_HUMAN PROTEIN (GP130)
1bqu A IL6RB_HUMAN PROTEIN (GP130)[208 aa] B 20.0
/29.9
10
/11
IL6RB_HUMAN PROTEIN (GP130)
3npz B PRLR_RAT Prolactin receptor[202 aa] C 15.4
/26.1
13
/15
PRLR_RAT Prolactin receptor
3npz C PRLR_RAT Prolactin receptor[199 aa] B 15.4
/25.7
13
/14
PRLR_RAT Prolactin receptor
3ew3 C PRLR_RAT Prolactin receptor[181 aa] B 10.0
/25.4
10
/11
PRLR_RAT Prolactin receptor
1f6f C PRLR_RAT PROLACTIN RECEPTOR[169 aa] B 10.0
/25.3
10
/11
PRLR_RAT PROLACTIN RECEPTOR
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6o4p K SO4
SULFATE ION[5 atoms]
A 0.0
/35.0
2
/2
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1bqu J SO4
SULFATE ION[5 atoms]
B 0.0
/29.9
3
/3
IL6RB_HUMAN PROTEIN (GP130)
6o4p H SO4
SULFATE ION[5 atoms]
A 0.0
/35.0
4
/4
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p G SO4
SULFATE ION[5 atoms]
A 0.0
/35.0
2
/2
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1bqu D SO4
SULFATE ION[5 atoms]
A 0.0
/30.2
1
/1
IL6RB_HUMAN PROTEIN (GP130)
6o4p O SO4
SULFATE ION[5 atoms]
B 0.0
/35.4
1
/1
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p M SO4
SULFATE ION[5 atoms]
B 0.0
/35.4
3
/3
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1n26 G SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
6o4p J SO4
SULFATE ION[5 atoms]
A 33.3
/35.0
3
/3
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p F SO4
SULFATE ION[5 atoms]
A 0.0
/35.0
4
/4
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p P SO4
SULFATE ION[5 atoms]
B 0.0
/35.4
1
/1
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1bqu H SO4
SULFATE ION[5 atoms]
B 0.0
/29.9
4
/4
IL6RB_HUMAN PROTEIN (GP130)
6o4p N SO4
SULFATE ION[5 atoms]
B 0.0
/35.4
1
/1
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p L SO4
SULFATE ION[5 atoms]
B 0.0
/35.4
2
/2
I11RA_HUMAN Interleukin-11 receptor subunit alpha
3l5h I SO4
SULFATE ION[5 atoms]
A 0.0
/28.8
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
1n26 F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
1bqu D SO4
SULFATE ION[5 atoms]
B 100.0
/29.9
1
/1
IL6RB_HUMAN PROTEIN (GP130)
1bqu E SO4
SULFATE ION[5 atoms]
A 100.0
/30.2
2
/2
IL6RB_HUMAN PROTEIN (GP130)
1bqu I SO4
SULFATE ION[5 atoms]
B 0.0
/29.9
2
/2
IL6RB_HUMAN PROTEIN (GP130)
3l5h J SO4
SULFATE ION[5 atoms]
A 0.0
/28.8
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
1bqu C SO4
SULFATE ION[5 atoms]
A 0.0
/30.2
4
/4
IL6RB_HUMAN PROTEIN (GP130)
1n26 F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
1n26 G SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
6o4p I SO4
SULFATE ION[5 atoms]
A 0.0
/35.0
1
/3
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1bqu F GOL
GLYCEROL[6 atoms]
A 50.0
/30.2
6
/6
IL6RB_HUMAN PROTEIN (GP130)
1bqu L GOL
GLYCEROL[6 atoms]
B 50.0
/29.9
6
/6
IL6RB_HUMAN PROTEIN (GP130)
4i18 K GOL
GLYCEROL[6 atoms]
E 83.3
/24.9
6
/6
PRLR_HUMAN Prolactin receptor
1bqu K GOL
GLYCEROL[6 atoms]
B 33.3
/29.9
6
/6
IL6RB_HUMAN PROTEIN (GP130)
1bqu M GOL
GLYCEROL[6 atoms]
B 25.0
/29.9
4
/4
IL6RB_HUMAN PROTEIN (GP130)
1bqu G GOL
GLYCEROL[6 atoms]
A 25.0
/30.2
8
/8
IL6RB_HUMAN PROTEIN (GP130)
3d87 E PO4
PHOSPHATE ION[5 atoms]
B 50.0
/28.8
2
/2
IL12B_HUMAN Interleukin-12 subunit p40
3d87 H PO4
PHOSPHATE ION[5 atoms]
D 50.0
/28.9
2
/2
IL12B_HUMAN Interleukin-12 subunit p40
5mj3 G PGE
TRIETHYLENE GLYCOL[10 atoms]
A 75.0
/28.3
4
/4
IL12B_HUMAN Interleukin-12 subunit beta
3d48 E CO3
CARBONATE ION[4 atoms]
B 75.0
/25.1
4
/4
PRLR_HUMAN Prolactin receptor
3ncc G CO3
CARBONATE ION[4 atoms]
B 0.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3d48 D CO3
CARBONATE ION[4 atoms]
B 50.0
/25.1
2
/2
PRLR_HUMAN Prolactin receptor
3d48 F CO3
CARBONATE ION[4 atoms]
B 12.5
/25.1
8
/8
PRLR_HUMAN Prolactin receptor
4i18 L ACT
ACETATE ION[4 atoms]
E 0.0
/24.9
2
/2
PRLR_HUMAN Prolactin receptor
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.