[Full Bars]

[SiteTable]


Summary Bars[0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57782 468 51 P08887(IL6RA_HUMAN) RecName: Full=Interleukin-6 receptor subunit alpha {ECO:0000305}; Short=IL-6 receptor subunit alpha; Short=IL-6R subunit alpha; Short=IL-6R-alpha; Short=IL-6RA;AltName: Full=IL-6R 1;AltName: Full=Membrane glycoprotein 80; Short=gp80;AltName: CD_antigen=CD126;Contains: RecName: Full=Soluble interleukin-6 receptor subunit alpha {ECO:0000305}; Short=sIL6R {ECO:0000303|PubMed:12794819, ECO:0000303|PubMed:26876177, ECO:0000303|PubMed:28060820};Flags: Precursor;
QUERYSEQ
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV
RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDA
RDPRSPYDISNTDYFFPR
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P08887(IL6RA_HUMAN)]

468
region name description
1-19 SIGNAL
20-468 CHAIN /note="Interleukin-6 receptor subunit alpha" /id="PRO_0000010895"
20-355 CHAIN /note="Soluble interleukin-6 receptor subunit alpha" /id="PRO_0000450730"
20-365 TOPO_DOM /note="Extracellular"
366-386 TRANSMEM /note="Helical"
387-468 TOPO_DOM /note="Cytoplasmic"
26-112 DOMAIN /note="Ig-like C2-type"
113-217 DOMAIN /note="Fibronectin type-III 1"
218-316 DOMAIN /note="Fibronectin type-III 2"
1-468 DISORDER predicted by DISOPRED (1-18,313-331,333-334,341-352,354-354,358-358,406-413,420-468)

MONOMER
468
pdb_id a1 identity[%]2 description
1n26 A 100.0 IL6A_HUMAN IL-6 Receptor alpha chain
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1p9m[2] A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0
8
/8
IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m[2] A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0
12
/12
IL6RA_HUMAN Interleukin-6 receptor alpha chain
5fuc[1] E VHH6[110 aa] C 100.0
/99.0
10
/10
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5fuc[1] F VHH6[124 aa] D 100.0
/99.0
10
/10
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5fuc[1] A IL6_HUMAN INTERLEUKIN-6[152 aa] D 100.0
/99.0
12
/12
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
1f45[1] B I12A_HUMAN INTERLEUKIN-12 ALPHA CHAIN[133 aa] A 25.0
/30.4
20
/21
I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
1pvh[2] B LIF_HUMAN Leukemia inhibitory factor[169 aa] A 23.1
/29.9
13
/13
IL6RB_HUMAN Interleukin-6 receptor beta chain
4grw[2] E Nanobody 124C4[125 aa] D 21.4
/28.5
14
/16
IL12B_HUMAN Interleukin-12 subunit beta
4grw[2] F Nanobody 37D5[125 aa] D 25.0
/28.5
4
/4
IL12B_HUMAN Interleukin-12 subunit beta
4grw[3] I Nanobody 22E11[123 aa] D 9.1
/28.5
11
/18
IL12B_HUMAN Interleukin-12 subunit beta
5njd[8] F IL23A_HUMAN Interleukin-23 subunit alpha[146 aa] E 20.0
/28.8
15
/16
IL12B_HUMAN Interleukin-12 subunit beta
6uib[1] A IL23A_HUMAN Interleukin-23 subunit alpha[132 aa] B 12.5
/28.6
16
/17
IL12B_HUMAN Interleukin-12 subunit beta
3d85[2] C IL23A_HUMAN Interleukin-23 subunit p19[133 aa] D 12.5
/28.3
16
/17
IL12B_HUMAN Interleukin-12 subunit p40
3hmx[1] D USTEKINUMAB FAB HEAVY CHAIN[217 aa] A 25.0
/29.0
12
/13
IL12B_HUMAN Interleukin-12 subunit beta
4i18[1] C antibody light chain[215 aa] E 60.0
/24.9
5
/5
PRLR_HUMAN Prolactin receptor
3hmx[1] C USTEKINUMAB FAB LIGHT CHAIN[214 aa] A 14.3
/29.0
7
/9
IL12B_HUMAN Interleukin-12 subunit beta
3hmx[1] B IL12A_HUMAN Interleukin-12 subunit alpha[176 aa] A 17.6
/29.0
17
/18
IL12B_HUMAN Interleukin-12 subunit beta
1p9m[2] C IL6RA_HUMAN Interleukin-6 receptor alpha chain[201 aa] A 10.0
/28.9
10
/11
IL6RB_HUMAN Interleukin-6 receptor beta chain
5fuc[1] B IL6_HUMAN INTERLEUKIN-6[160 aa] C 100.0
/99.0
18
/18
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
1p9m[2] B IL6_HUMAN Interleukin-6[163 aa] C 100.0
/100.0
15
/15
IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m[2] B IL6_HUMAN Interleukin-6[163 aa] A 33.3
/28.9
12
/12
IL6RB_HUMAN Interleukin-6 receptor beta chain
3qwr[1] C ADNECTIN[91 aa] A 28.6
/28.9
21
/22
IL12B_HUMAN Interleukin-12 subunit beta
6uib[1] C Peptide 23-652[15 aa] B 25.0
/28.6
12
/12
IL12B_HUMAN Interleukin-12 subunit beta
5njd[1] J IL23A_HUMAN Interleukin-23 subunit alpha[141 aa] I 18.8
/28.6
16
/16
IL12B_HUMAN Interleukin-12 subunit beta
3duh[1] C IL23A_HUMAN Interleukin-23 subunit alpha[137 aa] A 13.3
/28.6
15
/16
IL12B_HUMAN Interleukin-12 subunit beta
3duh[1] D IL23A_HUMAN Interleukin-23 subunit alpha[137 aa] B 12.5
/28.5
16
/17
IL12B_HUMAN Interleukin-12 subunit beta
5njd[6] V Briakinumab FAb Heavy chain[205 aa] A 0.0
/27.9
2
/10
IL12B_HUMAN Interleukin-12 subunit beta
5njd[6] U Briakinumab FAb Light chain[215 aa] A 0.0
/27.9
3
/8
IL12B_HUMAN Interleukin-12 subunit beta
3d87[4] C IL23A_HUMAN Interleukin-23 subunit p19[159 aa] D 18.8
/28.9
16
/17
IL12B_HUMAN Interleukin-12 subunit p40
3d87[1] C IL23A_HUMAN Interleukin-23 subunit p19[159 aa] B 0.0
/28.8
2
/2
IL12B_HUMAN Interleukin-12 subunit p40
1i1r[2] B Q98823_HHV8 VIRAL IL-6[167 aa] A 36.4
/28.2
11
/11
IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN
5mzv[1] B IL23A_HUMAN Interleukin-23 subunit alpha[137 aa] A 18.8
/28.0
16
/17
IL12B_HUMAN Interleukin-12 subunit beta
5mzv[1] C IL23R_HUMAN Interleukin-23 receptor[293 aa] A 0.0
/28.0
2
/6
IL12B_HUMAN Interleukin-12 subunit beta
3ew3[1] A PRL_HUMAN Prolactin[185 aa] B 0.0
/25.4
20
/21
PRLR_RAT Prolactin receptor
1f6f[1] A CSH_SHEEP PLACENTAL LACTOGEN[183 aa] B 4.5
/25.3
22
/23
PRLR_RAT PROLACTIN RECEPTOR
3d48[1] A PRL_HUMAN Prolactin[165 aa] B 0.0
/25.1
21
/22
PRLR_HUMAN Prolactin receptor
4i18[1] D antibody heavy chain[220 aa] E 20.0
/24.9
20
/21
PRLR_HUMAN Prolactin receptor
3n0p[9] A PRL_HUMAN Prolactin[186 aa] B 0.0
/24.7
21
/22
PRLR_HUMAN Prolactin receptor
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26[2] H CYS
CYSTEINE[7 atoms]
A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[4] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
6o4p[1] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/35.0
4
/4
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1n26[1] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[2] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
6uib[2] E NAG
N-ACETYL-D-GLUCOSAMINE[14 atoms]
B 0.0
/28.6
1
/3
IL12B_HUMAN Interleukin-12 subunit beta
3duh[2] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/28.6
2
/7
IL12B_HUMAN Interleukin-12 subunit beta
5fuc[2] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/99.0
2
/2
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
1f42[1] D MNB
5-MERCAPTO-2-NITRO-BENZOIC ACID[13 atoms]
A 50.0
/28.9
6
/6
I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
1f42[1] C MNB
5-MERCAPTO-2-NITRO-BENZOIC ACID[13 atoms]
A 66.7
/28.9
3
/3
I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
3d87[1] G MAN
alpha-D-mannopyranose[11 atoms]
D 0.0
/28.9
4
/4
IL12B_HUMAN Interleukin-12 subunit p40
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1pvh[1] E IOD
IODIDE ION[1 atoms]
A 100.0
/29.9
1
/1
IL6RB_HUMAN Interleukin-6 receptor beta chain
3d87[2] I K
POTASSIUM ION[1 atoms]
D 25.0
/28.9
4
/4
IL12B_HUMAN Interleukin-12 subunit p40
3ncb[7] G NA
SODIUM ION[1 atoms]
B 40.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
3mzg[7] C NA
SODIUM ION[1 atoms]
B 0.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3n0p[7] C NA
SODIUM ION[1 atoms]
B 0.0
/24.7
5
/5
PRLR_HUMAN Prolactin receptor
5mj3[1] I NA
SODIUM ION[1 atoms]
A 0.0
/28.3
3
/3
IL12B_HUMAN Interleukin-12 subunit beta
5mj3[1] H NA
SODIUM ION[1 atoms]
A 33.3
/28.3
3
/3
IL12B_HUMAN Interleukin-12 subunit beta
3nce[1] C NA
SODIUM ION[1 atoms]
B 0.0
/24.7
2
/3
PRLR_HUMAN Prolactin receptor
5mzv[1] K NA
SODIUM ION[1 atoms]
A 100.0
/28.0
1
/1
IL12B_HUMAN Interleukin-12 subunit beta
3ncf[7] E CL
CHLORIDE ION[1 atoms]
B 50.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
5mzv[1] J CL
CHLORIDE ION[1 atoms]
A 0.0
/28.0
2
/3
IL12B_HUMAN Interleukin-12 subunit beta
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26[2] B 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al.. A 100.0
/100.0
9
/9
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[2] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
3l5h[1] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/28.8
2
/2
IL6RB_HUMAN Interleukin-6 receptor subunit beta
6o4p[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/35.4
4
/4
I11RA_HUMAN Interleukin-11 receptor subunit alpha
5njd[8] Y alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 25.0
/27.9
4
/8
IL12B_HUMAN Interleukin-12 subunit beta
3hmx[3] E alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 0.0
/29.0
3
/7
IL12B_HUMAN Interleukin-12 subunit beta
1f45[2] C alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 0.0
/30.4
3
/7
I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
3l5h[1] C beta-D-mannopyranose-(1-4)-beta-D-mannopyranose-(1.. A 0.0
/28.8
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
5mzv[1] E alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 25.0
/28.0
4
/10
IL12B_HUMAN Interleukin-12 subunit beta
6o4p[1] C alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 0.0
/35.0
5
/5
I11RA_HUMAN Interleukin-11 receptor subunit alpha
3qwr[1] D alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 0.0
/28.9
3
/7
IL12B_HUMAN Interleukin-12 subunit beta
5mxa[1] C alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 0.0
/28.0
2
/8
IL12B_HUMAN Interleukin-12 subunit beta
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26[1] A IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] A 100.0
/100.0
15
/15
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[1] A IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] A 100.0
/100.0
11
/11
IL6A_HUMAN IL-6 Receptor alpha chain
1bqu[1] B IL6RB_HUMAN PROTEIN (GP130)[215 aa] A 33.3
/30.2
9
/9
IL6RB_HUMAN PROTEIN (GP130)
1bqu[1] A IL6RB_HUMAN PROTEIN (GP130)[208 aa] B 20.0
/29.9
10
/11
IL6RB_HUMAN PROTEIN (GP130)
3npz[2] B PRLR_RAT Prolactin receptor[202 aa] C 15.4
/26.1
13
/15
PRLR_RAT Prolactin receptor
3ew3[1] C PRLR_RAT Prolactin receptor[181 aa] B 10.0
/25.4
10
/11
PRLR_RAT Prolactin receptor
1f6f[1] C PRLR_RAT PROLACTIN RECEPTOR[169 aa] B 10.0
/25.3
10
/11
PRLR_RAT PROLACTIN RECEPTOR
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6o4p[2] K SO4
SULFATE ION[5 atoms]
A 0.0
/35.0
2
/2
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1bqu[1] J SO4
SULFATE ION[5 atoms]
B 0.0
/29.9
3
/3
IL6RB_HUMAN PROTEIN (GP130)
6o4p[7] H SO4
SULFATE ION[5 atoms]
A 0.0
/35.0
4
/4
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1bqu[3] D SO4
SULFATE ION[5 atoms]
A 0.0
/30.2
1
/1
IL6RB_HUMAN PROTEIN (GP130)
6o4p[1] M SO4
SULFATE ION[5 atoms]
B 0.0
/35.4
3
/3
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1n26[2] G SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
6o4p[1] P SO4
SULFATE ION[5 atoms]
B 0.0
/35.4
1
/1
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p[1] L SO4
SULFATE ION[5 atoms]
B 0.0
/35.4
2
/2
I11RA_HUMAN Interleukin-11 receptor subunit alpha
3l5h[1] I SO4
SULFATE ION[5 atoms]
A 0.0
/28.8
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
1n26[2] F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
1bqu[1] I SO4
SULFATE ION[5 atoms]
B 0.0
/29.9
2
/2
IL6RB_HUMAN PROTEIN (GP130)
3l5h[1] J SO4
SULFATE ION[5 atoms]
A 0.0
/28.8
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
6o4p[1] I SO4
SULFATE ION[5 atoms]
A 0.0
/35.0
1
/3
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1bqu[1] F GOL
GLYCEROL[6 atoms]
A 50.0
/30.2
6
/6
IL6RB_HUMAN PROTEIN (GP130)
1bqu[1] L GOL
GLYCEROL[6 atoms]
B 50.0
/29.9
6
/6
IL6RB_HUMAN PROTEIN (GP130)
4i18[1] K GOL
GLYCEROL[6 atoms]
E 83.3
/24.9
6
/6
PRLR_HUMAN Prolactin receptor
1bqu[2] K GOL
GLYCEROL[6 atoms]
B 33.3
/29.9
6
/6
IL6RB_HUMAN PROTEIN (GP130)
1bqu[1] M GOL
GLYCEROL[6 atoms]
B 25.0
/29.9
4
/4
IL6RB_HUMAN PROTEIN (GP130)
3d87[2] E PO4
PHOSPHATE ION[5 atoms]
B 50.0
/28.8
2
/2
IL12B_HUMAN Interleukin-12 subunit p40
5mj3[1] G PGE
TRIETHYLENE GLYCOL[10 atoms]
A 75.0
/28.3
4
/4
IL12B_HUMAN Interleukin-12 subunit beta
3d48[1] E CO3
CARBONATE ION[4 atoms]
B 75.0
/25.1
4
/4
PRLR_HUMAN Prolactin receptor
3ncc[1] G CO3
CARBONATE ION[4 atoms]
B 0.0
/24.7
2
/2
PRLR_HUMAN Prolactin receptor
3d48[1] D CO3
CARBONATE ION[4 atoms]
B 50.0
/25.1
2
/2
PRLR_HUMAN Prolactin receptor
3d48[1] F CO3
CARBONATE ION[4 atoms]
B 12.5
/25.1
8
/8
PRLR_HUMAN Prolactin receptor
4i18[1] L ACT
ACETATE ION[4 atoms]
E 0.0
/24.9
2
/2
PRLR_HUMAN Prolactin receptor
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.