[Full Bars]

[SiteTable]


Summary Bars[30 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57782 468 10 P08887(IL6RA_HUMAN) RecName: Full=Interleukin-6 receptor subunit alpha {ECO:0000305}; Short=IL-6 receptor subunit alpha; Short=IL-6R subunit alpha; Short=IL-6R-alpha; Short=IL-6RA;AltName: Full=IL-6R 1;AltName: Full=Membrane glycoprotein 80; Short=gp80;AltName: CD_antigen=CD126;Contains: RecName: Full=Soluble interleukin-6 receptor subunit alpha {ECO:0000305}; Short=sIL6R {ECO:0000303|PubMed:12794819, ECO:0000303|PubMed:26876177, ECO:0000303|PubMed:28060820};Flags: Precursor;
QUERYSEQ
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV
RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDA
RDPRSPYDISNTDYFFPR
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P08887(IL6RA_HUMAN)]

468
region name description
1-19 SIGNAL
20-468 CHAIN /note="Interleukin-6 receptor subunit alpha" /id="PRO_0000010895"
20-355 CHAIN /note="Soluble interleukin-6 receptor subunit alpha" /id="PRO_0000450730"
20-365 TOPO_DOM /note="Extracellular"
366-386 TRANSMEM /note="Helical"
387-468 TOPO_DOM /note="Cytoplasmic"
26-112 DOMAIN /note="Ig-like C2-type"
113-217 DOMAIN /note="Fibronectin type-III 1"
218-316 DOMAIN /note="Fibronectin type-III 2"
1-468 DISORDER predicted by DISOPRED (1-18,313-331,333-334,341-352,354-354,358-358,406-413,420-468)

MONOMER
468
pdb_id a1 identity[%]2 description
1n26 A 100.0 IL6A_HUMAN IL-6 Receptor alpha chain
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1p9m[2] B IL6_HUMAN Interleukin-6[163 aa] C 100.0
/100.0
15
/15
IL6RA_HUMAN Interleukin-6 receptor alpha chain
5fuc[1] B IL6_HUMAN INTERLEUKIN-6[160 aa] C 100.0
/99.0
18
/18
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
1p9m[2] A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0
8
/8
IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m[2] A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0
12
/12
IL6RA_HUMAN Interleukin-6 receptor alpha chain
5fuc[1] E VHH6[110 aa] C 100.0
/99.0
10
/10
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5fuc[1] A IL6_HUMAN INTERLEUKIN-6[152 aa] D 100.0
/99.0
12
/12
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5fuc[1] F VHH6[124 aa] D 100.0
/99.0
10
/10
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
1f45[1] B I12A_HUMAN INTERLEUKIN-12 ALPHA CHAIN[133 aa] A 25.0
/30.4
20
/21
I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26[2] H CYS
CYSTEINE[7 atoms]
A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[4] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[1] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[2] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
5fuc[2] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/99.0
2
/2
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
6o4p[1] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/35.0
4
/4
I11RA_HUMAN Interleukin-11 receptor subunit alpha
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26[2] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
6o4p[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/35.4
4
/4
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1n26[2] B 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al.. A 100.0
/100.0
9
/9
IL6A_HUMAN IL-6 Receptor alpha chain
6o4p[1] C alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 0.0
/35.0
5
/5
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1f45[1] C alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 0.0
/30.4
3
/7
I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26[1] A IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] A 100.0
/100.0
15
/15
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[1] A IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] A 100.0
/100.0
11
/11
IL6A_HUMAN IL-6 Receptor alpha chain
1bqu[1] B IL6RB_HUMAN PROTEIN (GP130)[215 aa] A 33.3
/30.2
9
/9
IL6RB_HUMAN PROTEIN (GP130)
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6o4p[1] P SO4
SULFATE ION[5 atoms]
B 0.0
/35.4
1
/1
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p[6] O SO4
SULFATE ION[5 atoms]
B 0.0
/35.4
1
/1
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p[1] M SO4
SULFATE ION[5 atoms]
B 0.0
/35.4
3
/3
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1n26[2] G SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[2] F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
6o4p[1] L SO4
SULFATE ION[5 atoms]
B 0.0
/35.4
2
/2
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1bqu[2] C SO4
SULFATE ION[5 atoms]
A 0.0
/30.2
4
/4
IL6RB_HUMAN PROTEIN (GP130)
6o4p[2] J SO4
SULFATE ION[5 atoms]
A 33.3
/35.0
3
/3
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p[1] I SO4
SULFATE ION[5 atoms]
A 0.0
/35.0
1
/3
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1bqu[1] F GOL
GLYCEROL[6 atoms]
A 50.0
/30.2
6
/6
IL6RB_HUMAN PROTEIN (GP130)
1bqu[1] G GOL
GLYCEROL[6 atoms]
A 25.0
/30.2
8
/8
IL6RB_HUMAN PROTEIN (GP130)
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.