[Summary Bars]

[SiteTable]


Full Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
36204 212 17 P05231(IL6_HUMAN) RecName: Full=Interleukin-6 {ECO:0000305}; Short=IL-6;AltName: Full=B-cell stimulatory factor 2; Short=BSF-2;AltName: Full=CTL differentiation factor; Short=CDF;AltName: Full=Hybridoma growth factor;AltName: Full=Interferon beta-2; Short=IFN-beta-2;Flags: Precursor;
QUERYSEQ
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVL
IQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P05231(IL6_HUMAN)]

212
region name description
1-29 SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
30-212 CHAIN /note="Interleukin-6" /id="PRO_0000015582"
1-43 DISORDER predicted by DISOPRED (1-14,28-28,32-43)

MONOMER
212
pdb_id a1 identity[%]2 description
4cni D 100.0 IL6_HUMAN INTERLEUKIN-6
4cni C 100.0 IL6_HUMAN INTERLEUKIN-6
4j4l D 100.0 IL6_HUMAN Interleukin-6
1il6 A 100.0 IL6_HUMAN INTERLEUKIN-6
2il6 A 100.0 IL6_HUMAN INTERLEUKIN-6
1p9m B 100.0 IL6_HUMAN Interleukin-6
1alu A 100.0 IL6_HUMAN INTERLEUKIN-6
5fuc B 100.0 IL6_HUMAN INTERLEUKIN-6
5fuc A 99.3 IL6_HUMAN INTERLEUKIN-6
4o9h A 100.0 IL6_HUMAN Interleukin-6
4j4l C 99.4 IL6_HUMAN Interleukin-6
4ni9 B 100.0 IL6_HUMAN Interleukin-6
4ni7 A 100.0 IL6_HUMAN Interleukin-6
4zs7 A 100.0 IL6_HUMAN Interleukin-6
4ni9 C 100.0 IL6_HUMAN Interleukin-6
2l3y A 40.7 IL6_MOUSE Interleukin-6
1i1r B 26.5 Q98823_HHV8 VIRAL IL-6
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
212 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4zs7 C Llama Fab fragment 68F2 light chain[210 aa] A 100.0
/100.0
11
/11
IL6_HUMAN Interleukin-6
4zs7 B Llama Fab fragment 68F2 heavy chain[222 aa] A 100.0
/100.0
13
/13
IL6_HUMAN Interleukin-6
4o9h C Light Chain of the Camelid Fab fragment 61H7[211 a.. A 100.0
/100.0
7
/7
IL6_HUMAN Interleukin-6
4o9h B Heavy Chain of the Camelid Fab fragment 61H7[200 a.. A 100.0
/100.0
10
/10
IL6_HUMAN Interleukin-6
1p9m C IL6RA_HUMAN Interleukin-6 receptor alpha chain[201 aa] B 100.0
/100.0
13
/13
IL6_HUMAN Interleukin-6
1p9m C IL6RA_HUMAN Interleukin-6 receptor alpha chain[201 aa] B 100.0
/100.0
13
/13
IL6_HUMAN Interleukin-6
5fuc D D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. A 100.0
/99.3
14
/14
IL6_HUMAN INTERLEUKIN-6
5fuc C D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. B 100.0
/100.0
19
/19
IL6_HUMAN INTERLEUKIN-6
4j4l A A4L9V2_LISMN Q4G1L3_EPTBU Internalin B,REPEAT MODULES,Variable lymphocyte re.. C 100.0
/99.4
18
/19
IL6_HUMAN Interleukin-6
4j4l B A4L9V2_LISMN Q4G1L3_EPTBU Internalin B,REPEAT MODULES,Variable lymphocyte re.. D 100.0
/100.0
18
/18
IL6_HUMAN Interleukin-6
4cni B OLOKIZUMAB LIGHT CHAIN, FAB PORTION[214 aa] D 100.0
/100.0
6
/6
IL6_HUMAN INTERLEUKIN-6
4cni F OLOKIZUMAB LIGHT CHAIN, FAB PORTION[214 aa] C 100.0
/100.0
6
/6
IL6_HUMAN INTERLEUKIN-6
4cni A OLOKIZUMAB HEAVY CHAIN, FAB PORTION[220 aa] D 100.0
/100.0
13
/13
IL6_HUMAN INTERLEUKIN-6
4cni E OLOKIZUMAB HEAVY CHAIN, FAB PORTION[219 aa] C 100.0
/100.0
13
/13
IL6_HUMAN INTERLEUKIN-6
1i1r A IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN[301 aa] B 0.0
/26.5
10
/11
Q98823_HHV8 VIRAL IL-6
1i1r A IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN[301 aa] B 26.3
/26.5
19
/19
Q98823_HHV8 VIRAL IL-6
1p9m A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] B 100.0
/100.0
14
/14
IL6_HUMAN Interleukin-6
1p9m A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] B 100.0
/100.0
12
/12
IL6_HUMAN Interleukin-6
1i1r A IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN[301 aa] B 0.0
/26.5
10
/11
Q98823_HHV8 VIRAL IL-6
1i1r A IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN[301 aa] B 26.3
/26.5
19
/19
Q98823_HHV8 VIRAL IL-6
1p9m A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] B 100.0
/100.0
14
/14
IL6_HUMAN Interleukin-6
1p9m A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] B 100.0
/100.0
12
/12
IL6_HUMAN Interleukin-6
5fuc E VHH6[110 aa] B 100.0
/100.0
7
/7
IL6_HUMAN INTERLEUKIN-6
5fuc F VHH6[124 aa] A 90.0
/99.3
10
/11
IL6_HUMAN INTERLEUKIN-6
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
212 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4ni9 D SOMAmer SL1025 C 100.0
/100.0
18
/18
IL6_HUMAN Interleukin-6
4ni9 A SOMAmer SL1025 C 100.0
/100.0
5
/5
IL6_HUMAN Interleukin-6
4ni9 A SOMAmer SL1025 B 100.0
/100.0
22
/22
IL6_HUMAN Interleukin-6
4ni9 D SOMAmer SL1025 B 100.0
/100.0
5
/5
IL6_HUMAN Interleukin-6
4ni7 B SOMAmer SL1025 A 100.0
/100.0
19
/19
IL6_HUMAN Interleukin-6
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
212 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4ni9 B IL6_HUMAN Interleukin-6[144 aa] C 100.0
/100.0
3
/3
IL6_HUMAN Interleukin-6
1alu A IL6_HUMAN INTERLEUKIN-6[157 aa] A 100.0
/100.0
22
/22
IL6_HUMAN INTERLEUKIN-6
1alu A IL6_HUMAN INTERLEUKIN-6[157 aa] A 100.0
/100.0
11
/11
IL6_HUMAN INTERLEUKIN-6
1alu A IL6_HUMAN INTERLEUKIN-6[157 aa] A 100.0
/100.0
22
/22
IL6_HUMAN INTERLEUKIN-6
4ni9 C IL6_HUMAN Interleukin-6[148 aa] B 100.0
/100.0
3
/3
IL6_HUMAN Interleukin-6
1alu A IL6_HUMAN INTERLEUKIN-6[157 aa] A 100.0
/100.0
11
/11
IL6_HUMAN INTERLEUKIN-6
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
212 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1alu F TLA
L(+)-TARTARIC ACID[10 atoms]
A 100.0
/100.0
4
/4
IL6_HUMAN INTERLEUKIN-6
1alu F TLA
L(+)-TARTARIC ACID[10 atoms]
A 100.0
/100.0
4
/4
IL6_HUMAN INTERLEUKIN-6
1alu F TLA
L(+)-TARTARIC ACID[10 atoms]
A 100.0
/100.0
4
/4
IL6_HUMAN INTERLEUKIN-6
1alu F TLA
L(+)-TARTARIC ACID[10 atoms]
A 100.0
/100.0
4
/4
IL6_HUMAN INTERLEUKIN-6
1alu F TLA
L(+)-TARTARIC ACID[10 atoms]
A 100.0
/100.0
4
/4
IL6_HUMAN INTERLEUKIN-6
1alu B SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
IL6_HUMAN INTERLEUKIN-6
1alu C SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
IL6_HUMAN INTERLEUKIN-6
1alu B SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
IL6_HUMAN INTERLEUKIN-6
1alu C SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
IL6_HUMAN INTERLEUKIN-6
1alu C SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
IL6_HUMAN INTERLEUKIN-6
1alu D SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
IL6_HUMAN INTERLEUKIN-6
1alu B SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
IL6_HUMAN INTERLEUKIN-6
1alu E SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
5
/5
IL6_HUMAN INTERLEUKIN-6
1alu D SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
IL6_HUMAN INTERLEUKIN-6
4cni J SO4
SULFATE ION[5 atoms]
D 100.0
/100.0
3
/3
IL6_HUMAN INTERLEUKIN-6
4cni K SO4
SULFATE ION[5 atoms]
D 100.0
/100.0
3
/3
IL6_HUMAN INTERLEUKIN-6
1alu D SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
IL6_HUMAN INTERLEUKIN-6
1alu C SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
IL6_HUMAN INTERLEUKIN-6
1alu E SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
5
/5
IL6_HUMAN INTERLEUKIN-6
1alu C SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
IL6_HUMAN INTERLEUKIN-6
4cni I SO4
SULFATE ION[5 atoms]
C 100.0
/100.0
3
/3
IL6_HUMAN INTERLEUKIN-6
4cni H SO4
SULFATE ION[5 atoms]
C 100.0
/100.0
4
/4
IL6_HUMAN INTERLEUKIN-6
1alu E SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
5
/5
IL6_HUMAN INTERLEUKIN-6
1alu B SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
IL6_HUMAN INTERLEUKIN-6
1alu B SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
IL6_HUMAN INTERLEUKIN-6
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.